EXPIRY DATE: 2025-09-24
We found more than 10,000 results (in 0.59 seconds) for your search in our Current WHOIS Database.
| Domain Name | Registered | Expiry | Registrar | Ownership | |
|---|---|---|---|---|---|
| 1 | vilpetrus.kred | 25 Sep 2015 | 24 Sep 2025 | TLD Registrar Pty Ltd | KredTLD Pty Ltd |
| 2 | xn--fiqs8sfmo4c.xn--czr694b | 24 Sep 2015 | 24 Sep 2025 | Guangdong HUYI Internet & IP Services Co.,Ltd | ???????????? |
| 3 | xn--lsv1b.xn--czr694b | 24 Sep 2015 | 24 Sep 2025 | Guangdong HUYI Internet & IP Services Co.,Ltd | ???????????? |
| 4 | wakeup.xn--czr694b | 24 Sep 2015 | 24 Sep 2025 | Hu Yi Global Information Hong Kong Limited | ???????? |
| 5 | doublemen.xn--czr694b | 24 Sep 2015 | 24 Sep 2025 | Hu Yi Global Information Hong Kong Limited | KWONG SHING TRADING AS SEE CHEONG GARMENT FTY |
| 6 | xn--sjq02jxqv.xn--czr694b | 24 Sep 2015 | 24 Sep 2025 | Hu Yi Global Information Hong Kong Limited | ???????? |
| 7 | xn--w4ry5ksq9a.xn--czr694b | 24 Sep 2015 | 24 Sep 2025 | Guangdong HUYI Internet & IP Services Co.,Ltd | ?????????????? |
| 8 | xn--fiqw8jhwbfytj5i07a.xn--czr694b | 24 Sep 2015 | 24 Sep 2025 | Guangdong HUYI Internet & IP Services Co.,Ltd | ?????? |
| 9 | xn--fiq7v14hnby2jsv9fpm8a.xn--czr694b | 24 Sep 2015 | 24 Sep 2025 | Guangdong HUYI Internet & IP Services Co.,Ltd | ?????? |
| 10 | xn--kbtpt25t5v0arlt.xn--czr694b | 24 Sep 2015 | 24 Sep 2025 | Guangdong HUYI Internet & IP Services Co.,Ltd | ???????(??)???? |
| 11 | xn--cks9z47i.xn--czr694b | 24 Sep 2015 | 24 Sep 2025 | Guangdong HUYI Internet & IP Services Co.,Ltd | ?????????????? |
| 12 | xn--czru2dgwx4c.xn--czr694b | 24 Sep 2015 | 24 Sep 2025 | Guangdong HUYI Internet & IP Services Co.,Ltd | ???????????? |
| 13 | xn--fiq7v14hea82wbz6b.xn--czr694b | 24 Sep 2015 | 24 Sep 2025 | Guangdong HUYI Internet & IP Services Co.,Ltd | ?????? |
| 14 | xn--fiq33nnlt0da782x34pus4a0f1b.xn--czr694b | 24 Sep 2015 | 24 Sep 2025 | Guangdong HUYI Internet & IP Services Co.,Ltd | ?????? |
| 15 | aojo.xn--czr694b | 24 Sep 2015 | 24 Sep 2025 | Hu Yi Global Information Hong Kong Limited | ?? |
| 16 | xn--gmq302a.xn--czr694b | 24 Sep 2015 | 24 Sep 2025 | Hu Yi Global Information Hong Kong Limited | KWONG OI WAN KATHY |
| 17 | xn--kbtt0zfcr82j.xn--czr694b | 24 Sep 2015 | 24 Sep 2025 | Guangdong HUYI Internet & IP Services Co.,Ltd | ???????????? |
| 18 | xn--czru2dy5fr2l4s9c.xn--czr694b | 24 Sep 2015 | 24 Sep 2025 | Guangdong HUYI Internet & IP Services Co.,Ltd | ???????(??)???? |
| 19 | xn--7py627c.xn--czr694b | 24 Sep 2015 | 24 Sep 2025 | Guangdong HUYI Internet & IP Services Co.,Ltd | ?????????? |
| 20 | compusales.com.mx | 25 Sep 2002 | 24 Sep 2025 | Akky (Una division de NIC Mexico) | COMPUSALES DE MEXICO S.A DE C.V |
| 21 | watertreatment.co.id | 24 Sep 2013 | 24 Sep 2025 | - | - |
| 22 | ipdisk.co.kr | 24 Sep 2010 | 24 Sep 2025 | (?)????? | (?)???????? |
| 23 | sidomuncul.co.id | 24 Sep 2013 | 24 Sep 2025 | - | - |
| 24 | fpe-sbsi.or.id | 24 Sep 2012 | 24 Sep 2025 | - | - |
| 25 | lakes.co.id | 24 Sep 2019 | 24 Sep 2025 | - | - |
| 26 | pavingblock.co.id | 24 Sep 2019 | 24 Sep 2025 | - | - |
| 27 | microdam.co.kr | 24 Sep 2004 | 24 Sep 2025 | (?)??? | (?)????? |
| 28 | kalitest.co.kr | 24 Sep 2010 | 24 Sep 2025 | (?)??? | ??? |
| 29 | nasos.uz | 23 Sep 2009 | 24 Sep 2025 | SARKOR TELECOM | - |
| 30 | hbtec.kr | 24 Sep 2017 | 24 Sep 2025 | (?)??? | ??? |
| 31 | fusion.mn | 24 Sep 2015 | 24 Sep 2025 | Datacom Co., Ltd. | Fusion consulting LLC |
| 32 | uspk.or.kr | 24 Sep 2004 | 24 Sep 2025 | (?)????? | ??? |
| 33 | miryangcc.co.kr | 24 Sep 2015 | 24 Sep 2025 | (?)??? | ??? ??? ??? |
| 34 | allogin.co.kr | 24 Sep 2014 | 24 Sep 2025 | (?)??? | ??? |
| 35 | icaritas.or.kr | 24 Sep 2001 | 24 Sep 2025 | (?)????? | (?)?????????? |
| 36 | ochairs.co.kr | 24 Sep 2010 | 24 Sep 2025 | (?)??? | ???? ???? |
| 37 | okkosher.co.kr | 24 Sep 2010 | 24 Sep 2025 | (?)??? | ??? |
| 38 | academyinfo.kr | 24 Sep 2012 | 24 Sep 2025 | (?)??? | ????????? |
| 39 | myco.gi | 24 Sep 2021 | 24 Sep 2025 | GibNet Registrar | MYCO LIMITED |
| 40 | mistwear.pl | 24 Sep 2020 | 24 Sep 2025 | home.pl S.A. | - |
| 41 | styl-projekt.pl | 24 Sep 2019 | 24 Sep 2025 | PERSKIMEDIA Szymon Perski | - |
| 42 | klimatech-glogow.pl | 24 Sep 2019 | 24 Sep 2025 | Globtel Internet Szymon Hersztek | - |
| 43 | stomatologia-jaworzynka.pl | 24 Sep 2018 | 24 Sep 2025 | OVH SAS | - |
| 44 | el-par.pl | 24 Sep 2015 | 24 Sep 2025 | Consulting Service Sp. z o.o. | - |
| 45 | frankfurt.pl | 25 Sep 2001 | 24 Sep 2025 | home.pl S.A. | - |
| 46 | ekontenery.pl | 24 Sep 2010 | 24 Sep 2025 | home.pl S.A. | - |
| 47 | silniki-zem.pl | 24 Sep 2014 | 24 Sep 2025 | home.pl S.A. | - |
| 48 | sppl.pl | 24 Sep 2018 | 24 Sep 2025 | OVH SAS | - |
| 49 | naszortodonta.pl | 24 Sep 2008 | 24 Sep 2025 | home.pl S.A. | - |
| 50 | komat.net.pl | 24 Sep 2021 | 24 Sep 2025 | Consulting Service Sp. z o.o. | - |
| 51 | tartaksapula.pl | 24 Sep 2019 | 24 Sep 2025 | Consulting Service Sp. z o.o. | - |
| 52 | altergeo.pl | 24 Sep 2020 | 24 Sep 2025 | OVH SAS | - |
| 53 | kancelariakredytywefrankach.pl | 24 Sep 2018 | 24 Sep 2025 | Consulting Service Sp. z o.o. | - |
| 54 | wszystkodlabiura.pl | 24 Sep 2018 | 24 Sep 2025 | cyber_Folks S.A. | - |
| 55 | viverno.pl | 24 Sep 2021 | 24 Sep 2025 | home.pl S.A. | - |
| 56 | ryczace20.pl | 24 Sep 2010 | 24 Sep 2025 | Domena.pl sp. z o.o. | - |
| 57 | najprzystojniejszy.pl | 24 Sep 2014 | 24 Sep 2025 | OVH SAS | - |
| 58 | energiadom.pl | 24 Sep 2018 | 24 Sep 2025 | nazwa.pl sp. z o.o. | - |
| 59 | fitamina.pl | 24 Sep 2014 | 24 Sep 2025 | OVH SAS | - |
| 60 | medi-car.pl | 24 Sep 2011 | 24 Sep 2025 | OVH SAS | - |
| 61 | biokompostownia.pl | 24 Sep 2018 | 24 Sep 2025 | home.pl S.A. | - |
| 62 | pracowniczenoclegi.pl | 24 Sep 2018 | 24 Sep 2025 | INFOCAL TECH sp. z o.o. | - |
| 63 | gwps.pl | 24 Sep 2003 | 24 Sep 2025 | Domena.pl sp. z o.o. | - |
| 64 | slodkachwila.pl | 24 Sep 2008 | 24 Sep 2025 | Domena.pl sp. z o.o. | - |
| 65 | hotelregent.pl | 24 Sep 2014 | 24 Sep 2025 | OVH SAS | - |
| 66 | kredyty-opole.pl | 24 Sep 2014 | 24 Sep 2025 | premium.pl Sp. z o.o. | - |
| 67 | stylowniawnetrz.pl | 24 Sep 2012 | 24 Sep 2025 | Consulting Service Sp. z o.o. | - |
| 68 | estromed.pl | 24 Sep 2015 | 24 Sep 2025 | Consulting Service Sp. z o.o. | - |
| 69 | oskextreme.pl | 24 Sep 2013 | 24 Sep 2025 | OVH SAS | - |
| 70 | mediabrokergroup.pl | 24 Sep 2017 | 24 Sep 2025 | home.pl S.A. | - |
| 71 | gminajaslo.pl | 25 Sep 2002 | 24 Sep 2025 | Domena.pl sp. z o.o. | - |
| 72 | longniddryinn.co.uk | 24 Sep 2009 | 24 Sep 2025 | Freeola Limited t/a Freeola and Get Dotted [Tag = FREEOLA] | - |
| 73 | leszcz.uk | 24 Sep 2017 | 24 Sep 2025 | OVH [Tag = OVH-FR] | - |
| 74 | szpital-braniewo.pl | 24 Sep 2015 | 24 Sep 2025 | Consulting Service Sp. z o.o. | - |
| 75 | annagilewska.pl | 24 Sep 2004 | 24 Sep 2025 | nazwa.pl sp. z o.o. | - |
| 76 | palacradomilow.pl | 24 Sep 2013 | 24 Sep 2025 | home.pl S.A. | - |
| 77 | wns.pl | 24 Sep 2003 | 24 Sep 2025 | nazwa.pl sp. z o.o. | - |
| 78 | thegardenapartment.co.uk | 24 Sep 2019 | 24 Sep 2025 | GoDaddy.com, LLC. [Tag = GODADDY] | - |
| 79 | survey.pl | 24 Sep 2014 | 24 Sep 2025 | Aftermarket.pl Limited | - |
| 80 | polna.com.pl | 25 Sep 2000 | 24 Sep 2025 | Domena.pl sp. z o.o. | - |
| 81 | doublegoldcoaching.co.uk | 24 Sep 2021 | 24 Sep 2025 | Ikiji Ltd t/a Ikiji [Tag = IKIJI] | - |
| 82 | stingteam.co.uk | 24 Sep 2023 | 24 Sep 2025 | 123-Reg Limited t/a 123-reg [Tag = 123-REG] | - |
| 83 | brandicarrfarm.co.uk | 24 Sep 2019 | 24 Sep 2025 | Fasthosts Internet Ltd [Tag = LIVEDOMAINS] | - |
| 84 | o1om.co.uk | 24 Sep 2023 | 24 Sep 2025 | Fasthosts Internet Ltd [Tag = LIVEDOMAINS] | - |
| 85 | cookiegirl.co.uk | 24 Sep 2004 | 24 Sep 2025 | Ionos SE [Tag = 1AND1] | - |
| 86 | hazlieburn.co.uk | 24 Sep 2021 | 24 Sep 2025 | Fasthosts Internet Ltd [Tag = LIVEDOMAINS] | - |
| 87 | bartlomiejsienkiewicz.pl | 24 Sep 2018 | 24 Sep 2025 | OVH SAS | - |
| 88 | londonfunctionalmedics.co.uk | 24 Sep 2023 | 24 Sep 2025 | 123-Reg Limited t/a 123-reg [Tag = 123-REG] | - |
| 89 | londoninternationalrallye.uk | 24 Sep 2023 | 24 Sep 2025 | GoDaddy.com, LLC. [Tag = GODADDY] | - |
| 90 | evolvefamily.co.uk | 24 Sep 2015 | 24 Sep 2025 | Fasthosts Internet Ltd [Tag = LIVEDOMAINS] | - |
| 91 | mellors.me.uk | 24 Sep 2009 | 24 Sep 2025 | Ionos SE [Tag = 1AND1] | - |
| 92 | stjamesconservation.co.uk | 24 Sep 2015 | 24 Sep 2025 | 123-Reg Limited t/a 123-reg [Tag = 123-REG] | - |
| 93 | crescent-grove.co.uk | 24 Sep 2019 | 24 Sep 2025 | GoDaddy.com, LLC. [Tag = GODADDY] | - |
| 94 | hiszpanskiodreki.pl | 24 Sep 2017 | 24 Sep 2025 | home.pl S.A. | - |
| 95 | dalintobertrading.co.uk | 24 Sep 2021 | 24 Sep 2025 | GoDaddy.com, LLC. [Tag = GODADDY] | - |
| 96 | brilliantroom.co.uk | 24 Sep 2003 | 24 Sep 2025 | LCN.com Ltd [Tag = LCN] | - |
| 97 | fizjolangchlasta.pl | 24 Sep 2021 | 24 Sep 2025 | Hosting Concepts B.V. | - |
| 98 | yarnandsinker.co.uk | 24 Sep 2023 | 24 Sep 2025 | 20i Ltd [Tag = STACK] | - |
| 99 | bijawellness.co.uk | 24 Sep 2023 | 24 Sep 2025 | 123-Reg Limited t/a 123-reg [Tag = 123-REG] | - |
| 100 | bijawellbeing.co.uk | 24 Sep 2023 | 24 Sep 2025 | 123-Reg Limited t/a 123-reg [Tag = 123-REG] | - |
In this page, we have listed the top 100 results. Kindly use our Reverse WHOIS API to fetch the remaining results.
You can fetch the above results in JSON or XML format through our API:
https://api.bigdomaindata.com/?key=XXXXX&database=current&expiry_date=2025-09-24
For more details, kindly see our Reverse WHOIS API usage guide.
{
"success": true,
"query": {
"database": "current",
"expiry_date": "2025-09-24",
"sort_by": "query_time",
"sort_order": "asc",
"page_size": 100
},
"count": {
"total": 10000,
"relation": "gte",
"current": 100
},
"unique_domains": "vilpetrus.kred, xn--fiqs8sfmo4c.xn--czr694b, xn--lsv1b.xn--czr694b, wakeup.xn--czr694b, doublemen.xn--czr694b, xn--sjq02jxqv.xn--czr694b, xn--w4ry5ksq9a.xn--czr694b, xn--fiqw8jhwbfytj5i07a.xn--czr694b, xn--fiq7v14hnby2jsv9fpm8a.xn--czr694b, xn--kbtpt25t5v0arlt.xn--czr694b, xn--cks9z47i.xn--czr694b, xn--czru2dgwx4c.xn--czr694b, xn--fiq7v14hea82wbz6b.xn--czr694b, xn--fiq33nnlt0da782x34pus4a0f1b.xn--czr694b, aojo.xn--czr694b, xn--gmq302a.xn--czr694b, xn--kbtt0zfcr82j.xn--czr694b, xn--czru2dy5fr2l4s9c.xn--czr694b, xn--7py627c.xn--czr694b, compusales.com.mx, watertreatment.co.id, ipdisk.co.kr, sidomuncul.co.id, fpe-sbsi.or.id, lakes.co.id, pavingblock.co.id, microdam.co.kr, kalitest.co.kr, nasos.uz, hbtec.kr, fusion.mn, uspk.or.kr, miryangcc.co.kr, allogin.co.kr, icaritas.or.kr, ochairs.co.kr, okkosher.co.kr, academyinfo.kr, myco.gi, mistwear.pl, styl-projekt.pl, klimatech-glogow.pl, stomatologia-jaworzynka.pl, el-par.pl, frankfurt.pl, ekontenery.pl, silniki-zem.pl, sppl.pl, naszortodonta.pl, komat.net.pl, tartaksapula.pl, altergeo.pl, kancelariakredytywefrankach.pl, wszystkodlabiura.pl, viverno.pl, ryczace20.pl, najprzystojniejszy.pl, energiadom.pl, fitamina.pl, medi-car.pl, biokompostownia.pl, pracowniczenoclegi.pl, gwps.pl, slodkachwila.pl, hotelregent.pl, kredyty-opole.pl, stylowniawnetrz.pl, estromed.pl, oskextreme.pl, mediabrokergroup.pl, gminajaslo.pl, longniddryinn.co.uk, leszcz.uk, szpital-braniewo.pl, annagilewska.pl, palacradomilow.pl, wns.pl, thegardenapartment.co.uk, survey.pl, polna.com.pl, doublegoldcoaching.co.uk, stingteam.co.uk, brandicarrfarm.co.uk, o1om.co.uk, cookiegirl.co.uk, hazlieburn.co.uk, bartlomiejsienkiewicz.pl, londonfunctionalmedics.co.uk, londoninternationalrallye.uk, evolvefamily.co.uk, mellors.me.uk, stjamesconservation.co.uk, crescent-grove.co.uk, hiszpanskiodreki.pl, dalintobertrading.co.uk, brilliantroom.co.uk, fizjolangchlasta.pl, yarnandsinker.co.uk, bijawellness.co.uk, bijawellbeing.co.uk",
"results": [
{
"num": 1,
"domain_name": "vilpetrus.kred",
"domain_keyword": "vilpetrus",
"domain_tld": "kred",
"query_time": "2015-09-25 00:00:00",
"create_date": "2015-09-25",
"expiry_date": "2025-09-24",
"registrar_iana": 1731,
"registrar_name": "TLD Registrar Pty Ltd",
"registrant_name": "Michael Deparini",
"registrant_company": "KredTLD Pty Ltd",
"registrant_address": "322/5 Lime St",
"registrant_city": "Sydney",
"registrant_state": "NSW",
"registrant_zip": "2000",
"registrant_country": "AU",
"registrant_email": "[email protected]",
"registrant_phone": "61292990499",
"name_servers": [
"ns-1431.awsdns-50.org",
"ns-1624.awsdns-11.co.uk",
"ns-367.awsdns-45.com",
"ns-685.awsdns-21.net"
],
"domain_status": [
"ok"
]
},
{
"num": 2,
"domain_name": "xn--fiqs8sfmo4c.xn--czr694b",
"domain_keyword": "xn--fiqs8sfmo4c",
"domain_tld": "xn--czr694b",
"query_time": "2015-09-26 00:00:00",
"create_date": "2015-09-24",
"expiry_date": "2025-09-24",
"registrar_iana": 1925,
"registrar_name": "Guangdong HUYI Internet & IP Services Co.,Ltd",
"registrant_name": "????????????",
"registrant_company": "????????????",
"registrant_address": "7/F, Chinachem Century Tower, No. 178 Gloucester Road, Wanchai,Hong Kong.",
"registrant_city": "??",
"registrant_state": "??",
"registrant_country": "CN",
"registrant_email": "[email protected]",
"registrant_phone": "864006281118",
"name_servers": [
"ns1.8hy.cn",
"ns2.8hy.cn"
],
"domain_status": [
"ok"
]
},
{
"num": 3,
"domain_name": "xn--lsv1b.xn--czr694b",
"domain_keyword": "xn--lsv1b",
"domain_tld": "xn--czr694b",
"query_time": "2015-09-26 00:00:00",
"create_date": "2015-09-24",
"expiry_date": "2025-09-24",
"registrar_iana": 1925,
"registrar_name": "Guangdong HUYI Internet & IP Services Co.,Ltd",
"registrant_name": "????????????",
"registrant_company": "????????????",
"registrant_address": "7/F, Chinachem Century Tower, No. 178 Gloucester Road, Wanchai,Hong Kong.",
"registrant_city": "??",
"registrant_state": "??",
"registrant_country": "CN",
"registrant_email": "[email protected]",
"registrant_phone": "864006281118",
"name_servers": [
"ns1.8hy.cn",
"ns2.8hy.cn"
],
"domain_status": [
"ok"
]
},
{
"num": 4,
"domain_name": "wakeup.xn--czr694b",
"domain_keyword": "wakeup",
"domain_tld": "xn--czr694b",
"query_time": "2015-09-26 00:00:00",
"create_date": "2015-09-24",
"expiry_date": "2025-09-24",
"registrar_iana": 1481,
"registrar_name": "Hu Yi Global Information Hong Kong Limited",
"registrant_name": "???",
"registrant_company": "????????",
"registrant_address": "7/F, Chinachem Century Tower, No. 178 Gloucester Road, Wanchai,Hong Kong.",
"registrant_city": "??",
"registrant_state": "??",
"registrant_country": "CN",
"registrant_email": "[email protected]",
"registrant_phone": "864006281118",
"name_servers": [
"ns1.8hy.cn",
"ns2.8hy.cn"
],
"domain_status": [
"ok"
]
},
{
"num": 5,
"domain_name": "doublemen.xn--czr694b",
"domain_keyword": "doublemen",
"domain_tld": "xn--czr694b",
"query_time": "2015-09-26 00:00:00",
"create_date": "2015-09-24",
"expiry_date": "2025-09-24",
"registrar_iana": 1481,
"registrar_name": "Hu Yi Global Information Hong Kong Limited",
"registrant_name": "KWONG SHING TRADING AS SEE CHEONG GARMENT FTY",
"registrant_company": "KWONG SHING TRADING AS SEE CHEONG GARMENT FTY",
"registrant_address": "7TH FLOOR, 1139 YIP KWONG INDUSTRIAL BUILDING, CANTON ROAD, MONGKOK, KOWLOON, HONG KONG",
"registrant_city": "HK",
"registrant_zip": "123456",
"registrant_country": "HK",
"registrant_email": "[email protected]",
"registrant_phone": "85223942449",
"registrant_fax": "8623970161",
"name_servers": [
"ns1.8hy.hk",
"ns2.8hy.hk"
],
"domain_status": [
"ok"
]
},
{
"num": 6,
"domain_name": "xn--sjq02jxqv.xn--czr694b",
"domain_keyword": "xn--sjq02jxqv",
"domain_tld": "xn--czr694b",
"query_time": "2015-09-26 00:00:00",
"create_date": "2015-09-24",
"expiry_date": "2025-09-24",
"registrar_iana": 1481,
"registrar_name": "Hu Yi Global Information Hong Kong Limited",
"registrant_name": "???",
"registrant_company": "????????",
"registrant_address": "7/F, Chinachem Century Tower, No. 178 Gloucester Road, Wanchai,Hong Kong.",
"registrant_city": "??",
"registrant_state": "??",
"registrant_country": "CN",
"registrant_email": "[email protected]",
"registrant_phone": "864006281118",
"name_servers": [
"ns1.8hy.cn",
"ns2.8hy.cn"
],
"domain_status": [
"ok"
]
},
{
"num": 7,
"domain_name": "xn--w4ry5ksq9a.xn--czr694b",
"domain_keyword": "xn--w4ry5ksq9a",
"domain_tld": "xn--czr694b",
"query_time": "2015-09-26 00:00:00",
"create_date": "2015-09-24",
"expiry_date": "2025-09-24",
"registrar_iana": 1925,
"registrar_name": "Guangdong HUYI Internet & IP Services Co.,Ltd",
"registrant_name": "??????????????",
"registrant_company": "??????????????",
"registrant_address": "7/F, Chinachem Century Tower, No. 178 Gloucester Road, Wanchai,Hong Kong.",
"registrant_city": "??",
"registrant_state": "??",
"registrant_country": "CN",
"registrant_email": "[email protected]",
"registrant_phone": "864006281118",
"name_servers": [
"ns1.8hy.cn",
"ns2.8hy.cn"
],
"domain_status": [
"ok"
]
},
{
"num": 8,
"domain_name": "xn--fiqw8jhwbfytj5i07a.xn--czr694b",
"domain_keyword": "xn--fiqw8jhwbfytj5i07a",
"domain_tld": "xn--czr694b",
"query_time": "2015-09-26 00:00:00",
"create_date": "2015-09-24",
"update_date": "2015-09-25",
"expiry_date": "2025-09-24",
"registrar_iana": 1925,
"registrar_name": "Guangdong HUYI Internet & IP Services Co.,Ltd",
"registrant_name": "??????",
"registrant_company": "??????",
"registrant_address": "7/F, Chinachem Century Tower, No. 178 Gloucester Road, Wanchai,Hong Kong.",
"registrant_city": "??",
"registrant_state": "??",
"registrant_country": "CN",
"registrant_email": "[email protected]",
"registrant_phone": "864006281118",
"name_servers": [
"ns1.8hy.cn",
"ns2.8hy.cn"
],
"domain_status": [
"ok"
]
},
{
"num": 9,
"domain_name": "xn--fiq7v14hnby2jsv9fpm8a.xn--czr694b",
"domain_keyword": "xn--fiq7v14hnby2jsv9fpm8a",
"domain_tld": "xn--czr694b",
"query_time": "2015-09-26 00:00:00",
"create_date": "2015-09-24",
"update_date": "2015-09-25",
"expiry_date": "2025-09-24",
"registrar_iana": 1925,
"registrar_name": "Guangdong HUYI Internet & IP Services Co.,Ltd",
"registrant_name": "??????",
"registrant_company": "??????",
"registrant_address": "7/F, Chinachem Century Tower, No. 178 Gloucester Road, Wanchai,Hong Kong.",
"registrant_city": "??",
"registrant_state": "??",
"registrant_country": "CN",
"registrant_email": "[email protected]",
"registrant_phone": "864006281118",
"name_servers": [
"ns1.8hy.cn",
"ns2.8hy.cn"
],
"domain_status": [
"ok"
]
},
{
"num": 10,
"domain_name": "xn--kbtpt25t5v0arlt.xn--czr694b",
"domain_keyword": "xn--kbtpt25t5v0arlt",
"domain_tld": "xn--czr694b",
"query_time": "2015-09-26 00:00:00",
"create_date": "2015-09-24",
"expiry_date": "2025-09-24",
"registrar_iana": 1925,
"registrar_name": "Guangdong HUYI Internet & IP Services Co.,Ltd",
"registrant_name": "???????(??)????",
"registrant_company": "???????(??)????",
"registrant_address": "7/F, Chinachem Century Tower, No. 178 Gloucester Road, Wanchai,Hong Kong.",
"registrant_city": "??",
"registrant_state": "??",
"registrant_country": "CN",
"registrant_email": "[email protected]",
"registrant_phone": "864006281118",
"name_servers": [
"ns1.8hy.cn",
"ns2.8hy.cn"
],
"domain_status": [
"ok"
]
},
{
"num": 11,
"domain_name": "xn--cks9z47i.xn--czr694b",
"domain_keyword": "xn--cks9z47i",
"domain_tld": "xn--czr694b",
"query_time": "2015-09-26 00:00:00",
"create_date": "2015-09-24",
"expiry_date": "2025-09-24",
"registrar_iana": 1925,
"registrar_name": "Guangdong HUYI Internet & IP Services Co.,Ltd",
"registrant_name": "???",
"registrant_company": "??????????????",
"registrant_address": "7/F, Chinachem Century Tower, No. 178 Gloucester Road, Wanchai,Hong Kong.",
"registrant_city": "??",
"registrant_state": "??",
"registrant_country": "CN",
"registrant_email": "[email protected]",
"registrant_phone": "864006281118",
"name_servers": [
"ns1.8hy.cn",
"ns2.8hy.cn"
],
"domain_status": [
"ok"
]
},
{
"num": 12,
"domain_name": "xn--czru2dgwx4c.xn--czr694b",
"domain_keyword": "xn--czru2dgwx4c",
"domain_tld": "xn--czr694b",
"query_time": "2015-09-26 00:00:00",
"create_date": "2015-09-24",
"expiry_date": "2025-09-24",
"registrar_iana": 1925,
"registrar_name": "Guangdong HUYI Internet & IP Services Co.,Ltd",
"registrant_name": "????????????",
"registrant_company": "????????????",
"registrant_address": "7/F, Chinachem Century Tower, No. 178 Gloucester Road, Wanchai,Hong Kong.",
"registrant_city": "??",
"registrant_state": "??",
"registrant_country": "CN",
"registrant_email": "[email protected]",
"registrant_phone": "864006281118",
"name_servers": [
"ns1.8hy.cn",
"ns2.8hy.cn"
],
"domain_status": [
"ok"
]
},
{
"num": 13,
"domain_name": "xn--fiq7v14hea82wbz6b.xn--czr694b",
"domain_keyword": "xn--fiq7v14hea82wbz6b",
"domain_tld": "xn--czr694b",
"query_time": "2015-09-26 00:00:00",
"create_date": "2015-09-24",
"update_date": "2015-09-25",
"expiry_date": "2025-09-24",
"registrar_iana": 1925,
"registrar_name": "Guangdong HUYI Internet & IP Services Co.,Ltd",
"registrant_name": "??????",
"registrant_company": "??????",
"registrant_address": "7/F, Chinachem Century Tower, No. 178 Gloucester Road, Wanchai,Hong Kong.",
"registrant_city": "??",
"registrant_state": "??",
"registrant_country": "CN",
"registrant_email": "[email protected]",
"registrant_phone": "864006281118",
"name_servers": [
"ns1.8hy.cn",
"ns2.8hy.cn"
],
"domain_status": [
"ok"
]
},
{
"num": 14,
"domain_name": "xn--fiq33nnlt0da782x34pus4a0f1b.xn--czr694b",
"domain_keyword": "xn--fiq33nnlt0da782x34pus4a0f1b",
"domain_tld": "xn--czr694b",
"query_time": "2015-09-26 00:00:00",
"create_date": "2015-09-24",
"update_date": "2015-09-25",
"expiry_date": "2025-09-24",
"registrar_iana": 1925,
"registrar_name": "Guangdong HUYI Internet & IP Services Co.,Ltd",
"registrant_name": "??????",
"registrant_company": "??????",
"registrant_address": "7/F, Chinachem Century Tower, No. 178 Gloucester Road, Wanchai,Hong Kong.",
"registrant_city": "??",
"registrant_state": "??",
"registrant_country": "CN",
"registrant_email": "[email protected]",
"registrant_phone": "864006281118",
"name_servers": [
"ns1.8hy.cn",
"ns2.8hy.cn"
],
"domain_status": [
"ok"
]
},
{
"num": 15,
"domain_name": "aojo.xn--czr694b",
"domain_keyword": "aojo",
"domain_tld": "xn--czr694b",
"query_time": "2015-09-26 00:00:00",
"create_date": "2015-09-24",
"expiry_date": "2025-09-24",
"registrar_iana": 1481,
"registrar_name": "Hu Yi Global Information Hong Kong Limited",
"registrant_name": "??",
"registrant_company": "??",
"registrant_address": "7/F, Chinachem Century Tower, No. 178 Gloucester Road, Wanchai,Hong Kong.",
"registrant_city": "??",
"registrant_state": "??",
"registrant_country": "CN",
"registrant_email": "[email protected]",
"registrant_phone": "864006281118",
"name_servers": [
"ns1.8hy.cn",
"ns2.8hy.cn"
],
"domain_status": [
"ok"
]
},
{
"num": 16,
"domain_name": "xn--gmq302a.xn--czr694b",
"domain_keyword": "xn--gmq302a",
"domain_tld": "xn--czr694b",
"query_time": "2015-09-26 00:00:00",
"create_date": "2015-09-24",
"expiry_date": "2025-09-24",
"registrar_iana": 1481,
"registrar_name": "Hu Yi Global Information Hong Kong Limited",
"registrant_name": "KWONG OI WAN KATHY",
"registrant_company": "KWONG OI WAN KATHY",
"registrant_address": "7TH FLOOR, 1139 YIP KWONG INDUSTRIAL BUILDING, CANTON ROAD, MONGKOK, KOWLOON, HONG KONG",
"registrant_city": "HK",
"registrant_zip": "123456",
"registrant_country": "HK",
"registrant_email": "[email protected]",
"registrant_phone": "85223942449",
"registrant_fax": "8623970161",
"name_servers": [
"ns1.8hy.hk",
"ns2.8hy.hk"
],
"domain_status": [
"ok"
]
},
{
"num": 17,
"domain_name": "xn--kbtt0zfcr82j.xn--czr694b",
"domain_keyword": "xn--kbtt0zfcr82j",
"domain_tld": "xn--czr694b",
"query_time": "2015-09-26 00:00:00",
"create_date": "2015-09-24",
"expiry_date": "2025-09-24",
"registrar_iana": 1925,
"registrar_name": "Guangdong HUYI Internet & IP Services Co.,Ltd",
"registrant_name": "????????????",
"registrant_company": "????????????",
"registrant_address": "7/F, Chinachem Century Tower, No. 178 Gloucester Road, Wanchai,Hong Kong.",
"registrant_city": "??",
"registrant_state": "??",
"registrant_country": "CN",
"registrant_email": "[email protected]",
"registrant_phone": "864006281118",
"name_servers": [
"ns1.8hy.cn",
"ns2.8hy.cn"
],
"domain_status": [
"ok"
]
},
{
"num": 18,
"domain_name": "xn--czru2dy5fr2l4s9c.xn--czr694b",
"domain_keyword": "xn--czru2dy5fr2l4s9c",
"domain_tld": "xn--czr694b",
"query_time": "2015-09-26 00:00:00",
"create_date": "2015-09-24",
"expiry_date": "2025-09-24",
"registrar_iana": 1925,
"registrar_name": "Guangdong HUYI Internet & IP Services Co.,Ltd",
"registrant_name": "???????(??)????",
"registrant_company": "???????(??)????",
"registrant_address": "7/F, Chinachem Century Tower, No. 178 Gloucester Road, Wanchai,Hong Kong.",
"registrant_city": "??",
"registrant_state": "??",
"registrant_country": "CN",
"registrant_email": "[email protected]",
"registrant_phone": "864006281118",
"name_servers": [
"ns1.8hy.cn",
"ns2.8hy.cn"
],
"domain_status": [
"ok"
]
},
{
"num": 19,
"domain_name": "xn--7py627c.xn--czr694b",
"domain_keyword": "xn--7py627c",
"domain_tld": "xn--czr694b",
"query_time": "2015-10-09 00:00:00",
"create_date": "2015-09-24",
"update_date": "2015-10-08",
"expiry_date": "2025-09-24",
"registrar_iana": 1925,
"registrar_name": "Guangdong HUYI Internet & IP Services Co.,Ltd",
"registrant_name": "??????????",
"registrant_company": "??????????",
"registrant_address": "7/F, Chinachem Century Tower, No. 178 Gloucester Road, Wanchai,Hong Kong.",
"registrant_city": "??",
"registrant_state": "??",
"registrant_country": "CN",
"registrant_email": "[email protected]",
"registrant_phone": "864006281118",
"name_servers": [
"ns1.8hy.cn",
"ns2.8hy.cn"
],
"domain_status": [
"ok"
]
},
{
"num": 20,
"domain_name": "compusales.com.mx",
"domain_keyword": "compusales",
"domain_tld": "com.mx",
"query_time": "2017-04-08 15:57:34",
"create_date": "2002-09-25",
"update_date": "2016-09-09",
"expiry_date": "2025-09-24",
"registrar_name": "Akky (Una division de NIC Mexico)",
"registrant_name": "COMPUSALES DE MEXICO S.A DE C.V",
"registrant_city": "MEXICO",
"registrant_state": "Distrito Federal",
"registrant_country": "MX",
"name_servers": [
"ns1.compusales.com.mx",
"ns2.compusales.com.mx"
]
},
{
"num": 21,
"domain_name": "watertreatment.co.id",
"domain_keyword": "watertreatment",
"domain_tld": "co.id",
"query_time": "2018-10-09 02:47:48",
"create_date": "2013-09-24",
"update_date": "2018-08-30",
"expiry_date": "2025-09-24",
"domain_status": [
"clientTransferProhibited",
"serverTransferProhibited"
]
},
{
"num": 22,
"domain_name": "ipdisk.co.kr",
"domain_keyword": "ipdisk",
"domain_tld": "co.kr",
"query_time": "2021-03-27 08:03:34",
"create_date": "2010-09-24",
"update_date": "2020-05-07",
"expiry_date": "2025-09-24",
"registrar_name": "(?)?????",
"registrar_website": "http://www.inames.co.kr",
"registrant_name": "(?)????????",
"registrant_address": "??? ??? ??? ??? 15 ????2 ?? 6? 6th Floor Benposra II B/D, 15 Jukjeon-ro Giheung-gu Yongin-si, Gyeonggi-do, KR",
"registrant_zip": "16897"
},
{
"num": 23,
"domain_name": "sidomuncul.co.id",
"domain_keyword": "sidomuncul",
"domain_tld": "co.id",
"query_time": "2021-12-13 04:31:28",
"create_date": "2013-09-24",
"update_date": "2020-07-24",
"expiry_date": "2025-09-24",
"domain_status": [
"clientTransferProhibited"
]
},
{
"num": 24,
"domain_name": "fpe-sbsi.or.id",
"domain_keyword": "fpe-sbsi",
"domain_tld": "or.id",
"query_time": "2022-06-08 16:38:32",
"create_date": "2012-09-24",
"update_date": "2022-02-17",
"expiry_date": "2025-09-24",
"domain_status": [
"ok"
]
},
{
"num": 25,
"domain_name": "lakes.co.id",
"domain_keyword": "lakes",
"domain_tld": "co.id",
"query_time": "2022-06-11 17:36:29",
"create_date": "2019-09-24",
"update_date": "2020-07-25",
"expiry_date": "2025-09-24",
"domain_status": [
"ok"
]
},
{
"num": 26,
"domain_name": "pavingblock.co.id",
"domain_keyword": "pavingblock",
"domain_tld": "co.id",
"query_time": "2022-06-15 19:29:40",
"create_date": "2019-09-24",
"update_date": "2020-08-01",
"expiry_date": "2025-09-24",
"domain_status": [
"clientTransferProhibited",
"serverTransferProhibited"
]
},
{
"num": 27,
"domain_name": "microdam.co.kr",
"domain_keyword": "microdam",
"domain_tld": "co.kr",
"query_time": "2022-06-19 02:55:55",
"create_date": "2004-09-24",
"update_date": "2021-10-12",
"expiry_date": "2025-09-24",
"registrar_name": "(?)???",
"registrar_website": "http://www.gabia.co.kr",
"registrant_name": "(?)?????",
"registrant_address": "?? ??? ??? 1327-27?? ??????? 315? . Seocho-gu, Suite #315, Hanhwa Obelisk, 1327-27 Seocho-dong",
"registrant_zip": "137070"
},
{
"num": 28,
"domain_name": "kalitest.co.kr",
"domain_keyword": "kalitest",
"domain_tld": "co.kr",
"query_time": "2022-06-21 06:27:31",
"create_date": "2010-09-24",
"update_date": "2011-05-20",
"expiry_date": "2025-09-24",
"registrar_name": "(?)???",
"registrar_website": "http://www.gabia.co.kr",
"registrant_name": "???"
},
{
"num": 29,
"domain_name": "nasos.uz",
"domain_keyword": "nasos",
"domain_tld": "uz",
"query_time": "2022-06-27 02:31:01",
"create_date": "2009-09-23",
"update_date": "2021-09-29",
"expiry_date": "2025-09-24",
"registrar_name": "SARKOR TELECOM",
"name_servers": [
"not.defined",
"ns1.jalolmurad.uz",
"ns2.jalolmurad.uz"
],
"domain_status": [
"ACTIVE"
]
},
{
"num": 30,
"domain_name": "hbtec.kr",
"domain_keyword": "hbtec",
"domain_tld": "kr",
"query_time": "2022-06-27 07:43:49",
"create_date": "2017-09-24",
"update_date": "2020-10-03",
"expiry_date": "2025-09-24",
"registrar_name": "(?)???",
"registrar_website": "http://www.gabia.co.kr",
"registrant_name": "???"
},
{
"num": 31,
"domain_name": "fusion.mn",
"domain_keyword": "fusion",
"domain_tld": "mn",
"query_time": "2022-06-27 10:06:37",
"create_date": "2015-09-24",
"update_date": "2021-05-07",
"expiry_date": "2025-09-24",
"registrar_iana": 119,
"registrar_name": "Datacom Co., Ltd.",
"registrar_website": "https://datacom.mn/",
"registrant_name": "Fujii Kazunori",
"registrant_company": "Fusion consulting LLC",
"registrant_address": "SBD-7 11 horoolol 5a-32",
"registrant_city": "ub",
"registrant_state": "Ulaanbaatar",
"registrant_zip": "976",
"registrant_country": "MN",
"registrant_email": "[email protected]",
"registrant_phone": "+976.95266919",
"name_servers": [
"ns1.dns.ne.jp",
"ns2.dns.ne.jp"
],
"domain_status": [
"ok"
]
},
{
"num": 32,
"domain_name": "uspk.or.kr",
"domain_keyword": "uspk",
"domain_tld": "or.kr",
"query_time": "2022-07-02 07:51:43",
"create_date": "2004-09-24",
"update_date": "2020-09-20",
"expiry_date": "2025-09-24",
"registrar_name": "(?)?????",
"registrar_website": "http://www.inames.co.kr",
"registrant_name": "???"
},
{
"num": 33,
"domain_name": "miryangcc.co.kr",
"domain_keyword": "miryangcc",
"domain_tld": "co.kr",
"query_time": "2022-07-03 21:41:11",
"create_date": "2015-09-24",
"update_date": "2020-08-17",
"expiry_date": "2025-09-24",
"registrar_name": "(?)???",
"registrar_website": "http://whois.co.kr",
"registrant_name": "??? ??? ???",
"registrant_address": "????? ??? ????34? 27 ??????? 3? 1101? #1101 Daerung post tower 182-4 guro3dong guro gu, Seoul",
"registrant_zip": "08378"
},
{
"num": 34,
"domain_name": "allogin.co.kr",
"domain_keyword": "allogin",
"domain_tld": "co.kr",
"query_time": "2022-07-03 22:18:04",
"create_date": "2014-09-24",
"update_date": "2014-12-01",
"expiry_date": "2025-09-24",
"registrar_name": "(?)???",
"registrar_website": "http://whois.co.kr",
"registrant_name": "???"
},
{
"num": 35,
"domain_name": "icaritas.or.kr",
"domain_keyword": "icaritas",
"domain_tld": "or.kr",
"query_time": "2022-07-05 10:39:59",
"create_date": "2001-09-24",
"update_date": "2013-11-25",
"expiry_date": "2025-09-24",
"registrar_name": "(?)?????",
"registrar_website": "http://www.inames.co.kr",
"registrant_name": "(?)??????????",
"registrant_address": "?? ?? ??? 323 Imam-dong, Nam-gu, Gwangju, Republic of Korea, 323, Gwangju, KR",
"registrant_zip": "503360"
},
{
"num": 36,
"domain_name": "ochairs.co.kr",
"domain_keyword": "ochairs",
"domain_tld": "co.kr",
"query_time": "2022-07-07 10:05:34",
"create_date": "2010-09-24",
"update_date": "2018-10-05",
"expiry_date": "2025-09-24",
"registrar_name": "(?)???",
"registrar_website": "http://www.gabia.co.kr",
"registrant_name": "???? ????"
},
{
"num": 37,
"domain_name": "okkosher.co.kr",
"domain_keyword": "okkosher",
"domain_tld": "co.kr",
"query_time": "2022-07-09 06:33:16",
"create_date": "2010-09-24",
"update_date": "2021-02-16",
"expiry_date": "2025-09-24",
"registrar_name": "(?)???",
"registrar_website": "http://www.gabia.co.kr",
"registrant_name": "???",
"registrant_address": "?? ??? ???? ??2? ????????? 102-1402 Ilsandong-gu, Goyang-si, Gyeonggi-do, Korea, 102-1402, Brown Stone Officetel, Baekseok 2-dong",
"registrant_zip": "410907"
},
{
"num": 38,
"domain_name": "academyinfo.kr",
"domain_keyword": "academyinfo",
"domain_tld": "kr",
"query_time": "2022-07-12 10:23:55",
"create_date": "2012-09-24",
"update_date": "2022-06-22",
"expiry_date": "2025-09-24",
"registrar_name": "(?)???",
"registrar_website": "http://www.gabia.co.kr",
"registrant_name": "?????????",
"registrant_address": "????? ??? ???? 606 ?????? A? 23? 606, Seobusaet-gil, Geumcheon-gu, Seoul,",
"registrant_zip": "08504"
},
{
"num": 39,
"domain_name": "myco.gi",
"domain_keyword": "myco",
"domain_tld": "gi",
"query_time": "2023-11-01 09:13:02",
"create_date": "2021-09-24",
"update_date": "2023-08-28",
"expiry_date": "2025-09-24",
"registrar_iana": 800072,
"registrar_name": "GibNet Registrar",
"registrant_name": "REDACTED FOR PRIVACY",
"registrant_company": "MYCO LIMITED",
"registrant_address": "REDACTED FOR PRIVACY",
"registrant_city": "REDACTED FOR PRIVACY",
"registrant_state": "Other",
"registrant_zip": "REDACTED FOR PRIVACY",
"registrant_country": "GI",
"registrant_email": "please query the rdds service of the registrar of record identified in this output for information on how to contact the registrant, admin, or tech contact of the queried domain name.",
"registrant_phone": "REDACTED FOR PRIVACY",
"registrant_fax": "REDACTED FOR PRIVACY",
"name_servers": [
"ns0.mylondonserver.com",
"ns1.mylondonserver.com"
],
"domain_status": [
"clientTransferProhibited"
],
"dns_sec": [
"unsigned"
]
},
{
"num": 40,
"domain_name": "mistwear.pl",
"domain_keyword": "mistwear",
"domain_tld": "pl",
"query_time": "2024-01-27 20:57:02",
"create_date": "2020-09-24",
"update_date": "2022-09-01",
"expiry_date": "2025-09-24",
"registrar_name": "home.pl S.A.",
"registrar_website": "https://home.pl/kontakt",
"name_servers": [
"dns.home.pl",
"dns2.home.pl",
"dns3.home.pl"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 41,
"domain_name": "styl-projekt.pl",
"domain_keyword": "styl-projekt",
"domain_tld": "pl",
"query_time": "2024-02-19 12:23:48",
"create_date": "2019-09-24",
"update_date": "2023-10-19",
"expiry_date": "2025-09-24",
"registrar_name": "PERSKIMEDIA Szymon Perski",
"name_servers": [
"ns1.seohost.pl",
"ns2.seohost.pl"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 42,
"domain_name": "klimatech-glogow.pl",
"domain_keyword": "klimatech-glogow",
"domain_tld": "pl",
"query_time": "2024-02-29 20:33:26",
"create_date": "2019-09-24",
"update_date": "2023-09-03",
"expiry_date": "2025-09-24",
"registrar_name": "Globtel Internet Szymon Hersztek",
"name_servers": [
"ns5.webd.pl",
"ns7.webd.pl"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 43,
"domain_name": "stomatologia-jaworzynka.pl",
"domain_keyword": "stomatologia-jaworzynka",
"domain_tld": "pl",
"query_time": "2024-03-03 15:57:11",
"create_date": "2018-09-24",
"update_date": "2023-09-05",
"expiry_date": "2025-09-24",
"registrar_name": "OVH SAS",
"registrar_website": "https://www.ovhcloud.com",
"name_servers": [
"ns.lh.pl",
"ns2.lh.pl",
"ns2.lighthosting.net"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 44,
"domain_name": "el-par.pl",
"domain_keyword": "el-par",
"domain_tld": "pl",
"query_time": "2024-03-07 12:50:19",
"create_date": "2015-09-24",
"update_date": "2023-11-24",
"expiry_date": "2025-09-24",
"registrar_name": "Consulting Service Sp. z o.o.",
"name_servers": [
"ns1.i-host.pl",
"ns2.i-host.pl"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 45,
"domain_name": "frankfurt.pl",
"domain_keyword": "frankfurt",
"domain_tld": "pl",
"query_time": "2024-03-07 23:02:16",
"create_date": "2001-09-25",
"update_date": "2020-09-23",
"expiry_date": "2025-09-24",
"registrar_name": "home.pl S.A.",
"registrar_website": "https://home.pl/kontakt",
"name_servers": [
"ns1.racken.eu",
"ns2.racken.eu"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 46,
"domain_name": "ekontenery.pl",
"domain_keyword": "ekontenery",
"domain_tld": "pl",
"query_time": "2024-03-08 00:40:10",
"create_date": "2010-09-24",
"update_date": "2020-05-21",
"expiry_date": "2025-09-24",
"registrar_name": "home.pl S.A.",
"registrar_website": "https://home.pl/kontakt",
"name_servers": [
"dns.home.pl",
"dns2.home.pl",
"dns3.home.pl"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 47,
"domain_name": "silniki-zem.pl",
"domain_keyword": "silniki-zem",
"domain_tld": "pl",
"query_time": "2024-03-08 08:58:36",
"create_date": "2014-09-24",
"update_date": "2023-09-19",
"expiry_date": "2025-09-24",
"registrar_name": "home.pl S.A.",
"registrar_website": "https://home.pl/kontakt",
"name_servers": [
"dns.home.pl",
"dns2.home.pl",
"dns3.home.pl"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 48,
"domain_name": "sppl.pl",
"domain_keyword": "sppl",
"domain_tld": "pl",
"query_time": "2024-03-09 08:22:58",
"create_date": "2018-09-24",
"update_date": "2023-09-25",
"expiry_date": "2025-09-24",
"registrar_name": "OVH SAS",
"registrar_website": "https://www.ovhcloud.com",
"name_servers": [
"dns112.ovh.net",
"ns112.ovh.net"
],
"dns_sec": [
"Signed"
]
},
{
"num": 49,
"domain_name": "naszortodonta.pl",
"domain_keyword": "naszortodonta",
"domain_tld": "pl",
"query_time": "2024-03-09 10:02:02",
"create_date": "2008-09-24",
"update_date": "2022-08-08",
"expiry_date": "2025-09-24",
"registrar_name": "home.pl S.A.",
"registrar_website": "https://home.pl/kontakt",
"name_servers": [
"ns1.smsy.co.pl",
"ns2.smsy.co.pl"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 50,
"domain_name": "komat.net.pl",
"domain_keyword": "komat",
"domain_tld": "net.pl",
"query_time": "2024-03-09 10:06:29",
"create_date": "2021-09-24",
"update_date": "2023-11-08",
"expiry_date": "2025-09-24",
"registrar_name": "Consulting Service Sp. z o.o.",
"name_servers": [
"ns1.i-host.pl",
"ns2.i-host.pl"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 51,
"domain_name": "tartaksapula.pl",
"domain_keyword": "tartaksapula",
"domain_tld": "pl",
"query_time": "2024-03-10 10:33:13",
"create_date": "2019-09-24",
"update_date": "2022-05-30",
"expiry_date": "2025-09-24",
"registrar_name": "Consulting Service Sp. z o.o.",
"name_servers": [
"ns1.i-host.pl",
"ns2.i-host.pl"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 52,
"domain_name": "altergeo.pl",
"domain_keyword": "altergeo",
"domain_tld": "pl",
"query_time": "2024-03-11 01:54:12",
"create_date": "2020-09-24",
"update_date": "2023-09-20",
"expiry_date": "2025-09-24",
"registrar_name": "OVH SAS",
"registrar_website": "https://www.ovhcloud.com",
"name_servers": [
"dns112.ovh.net",
"ns112.ovh.net"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 53,
"domain_name": "kancelariakredytywefrankach.pl",
"domain_keyword": "kancelariakredytywefrankach",
"domain_tld": "pl",
"query_time": "2024-03-11 15:30:14",
"create_date": "2018-09-24",
"update_date": "2022-06-30",
"expiry_date": "2025-09-24",
"registrar_name": "Consulting Service Sp. z o.o.",
"name_servers": [
"ns1.zenbox.pl",
"ns2.zenbox.pl"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 54,
"domain_name": "wszystkodlabiura.pl",
"domain_keyword": "wszystkodlabiura",
"domain_tld": "pl",
"query_time": "2024-03-12 15:44:23",
"create_date": "2018-09-24",
"update_date": "2022-08-23",
"expiry_date": "2025-09-24",
"registrar_name": "cyber_Folks S.A.",
"name_servers": [
"ns1.ssd-dns.pl",
"ns2.ssd-dns.pl"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 55,
"domain_name": "viverno.pl",
"domain_keyword": "viverno",
"domain_tld": "pl",
"query_time": "2024-03-12 21:31:27",
"create_date": "2021-09-24",
"update_date": "2023-08-25",
"expiry_date": "2025-09-24",
"registrar_name": "home.pl S.A.",
"registrar_website": "https://home.pl/kontakt",
"name_servers": [
"dns.home.pl",
"dns2.home.pl",
"dns3.home.pl"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 56,
"domain_name": "ryczace20.pl",
"domain_keyword": "ryczace20",
"domain_tld": "pl",
"query_time": "2024-03-13 05:51:49",
"create_date": "2010-09-24",
"update_date": "2023-08-29",
"expiry_date": "2025-09-24",
"registrar_name": "Domena.pl sp. z o.o.",
"registrar_website": "www.domena.pl",
"name_servers": [
"ns1.looz.com.pl",
"ns2.looz.com.pl",
"ns3.looz.com.pl"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 57,
"domain_name": "najprzystojniejszy.pl",
"domain_keyword": "najprzystojniejszy",
"domain_tld": "pl",
"query_time": "2024-03-13 19:05:32",
"create_date": "2014-09-24",
"update_date": "2022-04-25",
"expiry_date": "2025-09-24",
"registrar_name": "OVH SAS",
"registrar_website": "https://www.ovhcloud.com",
"name_servers": [
"dns1.mydevil.net",
"dns2.mydevil.net"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 58,
"domain_name": "energiadom.pl",
"domain_keyword": "energiadom",
"domain_tld": "pl",
"query_time": "2024-03-14 22:18:44",
"create_date": "2018-09-24",
"update_date": "2020-09-14",
"expiry_date": "2025-09-24",
"registrar_name": "nazwa.pl sp. z o.o.",
"registrar_website": "www.nazwa.pl",
"name_servers": [
"ns1.nazwa.pl",
"ns2.nazwa.pl",
"ns3.nazwa.pl"
],
"dns_sec": [
"Signed"
]
},
{
"num": 59,
"domain_name": "fitamina.pl",
"domain_keyword": "fitamina",
"domain_tld": "pl",
"query_time": "2024-03-14 22:58:02",
"create_date": "2014-09-24",
"update_date": "2022-09-06",
"expiry_date": "2025-09-24",
"registrar_name": "OVH SAS",
"registrar_website": "https://www.ovhcloud.com",
"name_servers": [
"ns1.zenbox.pl",
"ns2.zenbox.pl"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 60,
"domain_name": "medi-car.pl",
"domain_keyword": "medi-car",
"domain_tld": "pl",
"query_time": "2024-03-15 00:16:02",
"create_date": "2011-09-24",
"update_date": "2024-01-01",
"expiry_date": "2025-09-24",
"registrar_name": "OVH SAS",
"registrar_website": "https://www.ovhcloud.com",
"name_servers": [
"ns1.hekko.net.pl",
"ns2.hekko.net.pl"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 61,
"domain_name": "biokompostownia.pl",
"domain_keyword": "biokompostownia",
"domain_tld": "pl",
"query_time": "2024-03-16 19:02:13",
"create_date": "2018-09-24",
"update_date": "2023-08-29",
"expiry_date": "2025-09-24",
"registrar_name": "home.pl S.A.",
"registrar_website": "https://home.pl/kontakt",
"name_servers": [
"ns1.superhost.pl",
"ns2.superhost.pl"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 62,
"domain_name": "pracowniczenoclegi.pl",
"domain_keyword": "pracowniczenoclegi",
"domain_tld": "pl",
"query_time": "2024-03-17 16:22:27",
"create_date": "2018-09-24",
"update_date": "2023-10-23",
"expiry_date": "2025-09-24",
"registrar_name": "INFOCAL TECH sp. z o.o.",
"name_servers": [
"ns1.iq.pl",
"ns2.iq.pl"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 63,
"domain_name": "gwps.pl",
"domain_keyword": "gwps",
"domain_tld": "pl",
"query_time": "2024-03-17 18:14:02",
"create_date": "2003-09-24",
"update_date": "2023-09-18",
"expiry_date": "2025-09-24",
"registrar_name": "Domena.pl sp. z o.o.",
"registrar_website": "www.domena.pl",
"name_servers": [
"dns11.linuxpl.com",
"ns11.linuxpl.com"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 64,
"domain_name": "slodkachwila.pl",
"domain_keyword": "slodkachwila",
"domain_tld": "pl",
"query_time": "2024-03-19 02:04:26",
"create_date": "2008-09-24",
"update_date": "2024-01-23",
"expiry_date": "2025-09-24",
"registrar_name": "Domena.pl sp. z o.o.",
"registrar_website": "www.domena.pl",
"name_servers": [
"ns1.domena.pl",
"ns2.domena.pl",
"ns3.domena.pl"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 65,
"domain_name": "hotelregent.pl",
"domain_keyword": "hotelregent",
"domain_tld": "pl",
"query_time": "2024-03-20 06:08:42",
"create_date": "2014-09-24",
"update_date": "2018-09-28",
"expiry_date": "2025-09-24",
"registrar_name": "OVH SAS",
"registrar_website": "https://www.ovhcloud.com",
"name_servers": [
"dns109.ovh.net",
"ns109.ovh.net"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 66,
"domain_name": "kredyty-opole.pl",
"domain_keyword": "kredyty-opole",
"domain_tld": "pl",
"query_time": "2024-03-21 01:08:03",
"create_date": "2014-09-24",
"update_date": "2024-02-02",
"expiry_date": "2025-09-24",
"registrar_name": "premium.pl Sp. z o.o.",
"registrar_website": "https://premium.pl/kontakt",
"name_servers": [
"ns1.kylos.pl",
"ns2.kylos.pl"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 67,
"domain_name": "stylowniawnetrz.pl",
"domain_keyword": "stylowniawnetrz",
"domain_tld": "pl",
"query_time": "2024-03-21 08:08:28",
"create_date": "2012-09-24",
"update_date": "2023-09-18",
"expiry_date": "2025-09-24",
"registrar_name": "Consulting Service Sp. z o.o.",
"name_servers": [
"dns.home.pl",
"dns2.home.pl"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 68,
"domain_name": "estromed.pl",
"domain_keyword": "estromed",
"domain_tld": "pl",
"query_time": "2024-03-22 02:05:10",
"create_date": "2015-09-24",
"update_date": "2022-09-01",
"expiry_date": "2025-09-24",
"registrar_name": "Consulting Service Sp. z o.o.",
"name_servers": [
"ns1.jchost11.pl",
"ns2.jchost11.pl"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 69,
"domain_name": "oskextreme.pl",
"domain_keyword": "oskextreme",
"domain_tld": "pl",
"query_time": "2024-03-22 22:20:16",
"create_date": "2013-09-24",
"update_date": "2022-09-10",
"expiry_date": "2025-09-24",
"registrar_name": "OVH SAS",
"registrar_website": "https://www.ovhcloud.com",
"name_servers": [
"ns1.zenbox.pl",
"ns2.zenbox.pl"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 70,
"domain_name": "mediabrokergroup.pl",
"domain_keyword": "mediabrokergroup",
"domain_tld": "pl",
"query_time": "2024-03-23 13:00:29",
"create_date": "2017-09-24",
"update_date": "2023-09-11",
"expiry_date": "2025-09-24",
"registrar_name": "home.pl S.A.",
"registrar_website": "https://home.pl/kontakt",
"name_servers": [
"dns.home.pl",
"dns2.home.pl",
"dns3.home.pl"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 71,
"domain_name": "gminajaslo.pl",
"domain_keyword": "gminajaslo",
"domain_tld": "pl",
"query_time": "2024-03-23 17:19:56",
"create_date": "2002-09-25",
"update_date": "2024-01-25",
"expiry_date": "2025-09-24",
"registrar_name": "Domena.pl sp. z o.o.",
"registrar_website": "www.domena.pl",
"name_servers": [
"ns1.domena.pl",
"ns2.domena.pl",
"ns3.domena.pl"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 72,
"domain_name": "longniddryinn.co.uk",
"domain_keyword": "longniddryinn",
"domain_tld": "co.uk",
"query_time": "2024-03-25 13:40:20",
"create_date": "2009-09-24",
"update_date": "2023-11-12",
"expiry_date": "2025-09-24",
"registrar_name": "Freeola Limited t/a Freeola and Get Dotted [Tag = FREEOLA]",
"registrar_website": "https://GetDotted.com",
"name_servers": [
"ns3.freeola.net",
"ns4.freeola.net"
],
"domain_status": [
"Registered until expiry date."
]
},
{
"num": 73,
"domain_name": "leszcz.uk",
"domain_keyword": "leszcz",
"domain_tld": "uk",
"query_time": "2024-03-25 14:23:21",
"create_date": "2017-09-24",
"update_date": "2022-06-27",
"expiry_date": "2025-09-24",
"registrar_name": "OVH [Tag = OVH-FR]",
"registrar_website": "http://www.ovh.com",
"name_servers": [
"dns104.ovh.net",
"ns104.ovh.net"
],
"domain_status": [
"Registered until expiry date."
]
},
{
"num": 74,
"domain_name": "szpital-braniewo.pl",
"domain_keyword": "szpital-braniewo",
"domain_tld": "pl",
"query_time": "2024-03-25 17:42:48",
"create_date": "2015-09-24",
"update_date": "2023-10-21",
"expiry_date": "2025-09-24",
"registrar_name": "Consulting Service Sp. z o.o.",
"name_servers": [
"ns1.cyberfolks.pl",
"ns2.cyberfolks.pl",
"ns3.cyberfolks.pl"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 75,
"domain_name": "annagilewska.pl",
"domain_keyword": "annagilewska",
"domain_tld": "pl",
"query_time": "2024-03-26 03:57:15",
"create_date": "2004-09-24",
"update_date": "2023-11-12",
"expiry_date": "2025-09-24",
"registrar_name": "nazwa.pl sp. z o.o.",
"registrar_website": "www.nazwa.pl",
"name_servers": [
"ns1.dhosting.pl",
"ns2.dhosting.pl"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 76,
"domain_name": "palacradomilow.pl",
"domain_keyword": "palacradomilow",
"domain_tld": "pl",
"query_time": "2024-03-27 07:24:42",
"create_date": "2013-09-24",
"update_date": "2023-02-12",
"expiry_date": "2025-09-24",
"registrar_name": "home.pl S.A.",
"registrar_website": "https://home.pl/kontakt",
"name_servers": [
"ns1.cyberfolks.pl",
"ns2.cyberfolks.pl",
"ns3.cyberfolks.pl"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 77,
"domain_name": "wns.pl",
"domain_keyword": "wns",
"domain_tld": "pl",
"query_time": "2024-03-27 08:58:26",
"create_date": "2003-09-24",
"update_date": "2023-03-01",
"expiry_date": "2025-09-24",
"registrar_name": "nazwa.pl sp. z o.o.",
"registrar_website": "www.nazwa.pl",
"name_servers": [
"ns1.nazwa.pl",
"ns2.nazwa.pl",
"ns3.nazwa.pl"
],
"dns_sec": [
"Signed"
]
},
{
"num": 78,
"domain_name": "thegardenapartment.co.uk",
"domain_keyword": "thegardenapartment",
"domain_tld": "co.uk",
"query_time": "2024-03-29 03:31:53",
"create_date": "2019-09-24",
"update_date": "2023-09-25",
"expiry_date": "2025-09-24",
"registrar_name": "GoDaddy.com, LLC. [Tag = GODADDY]",
"registrar_website": "http://uk.godaddy.com",
"name_servers": [
"ns19.domaincontrol.com",
"ns20.domaincontrol.com"
],
"domain_status": [
"Registered until expiry date."
]
},
{
"num": 79,
"domain_name": "survey.pl",
"domain_keyword": "survey",
"domain_tld": "pl",
"query_time": "2024-03-29 08:46:04",
"create_date": "2014-09-24",
"update_date": "2023-11-16",
"expiry_date": "2025-09-24",
"registrar_name": "Aftermarket.pl Limited",
"registrar_website": "http://www.AfterMarket.pl/contact.php",
"name_servers": [
"ns1.aftermarket.pl",
"ns2.aftermarket.pl"
],
"dns_sec": [
"Signed"
]
},
{
"num": 80,
"domain_name": "polna.com.pl",
"domain_keyword": "polna",
"domain_tld": "com.pl",
"query_time": "2024-03-29 12:52:09",
"create_date": "2000-09-25",
"update_date": "2023-09-05",
"expiry_date": "2025-09-24",
"registrar_name": "Domena.pl sp. z o.o.",
"registrar_website": "www.domena.pl",
"name_servers": [
"dns1.spider.pl",
"dns2.spider.pl"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 81,
"domain_name": "doublegoldcoaching.co.uk",
"domain_keyword": "doublegoldcoaching",
"domain_tld": "co.uk",
"query_time": "2024-03-29 13:20:13",
"create_date": "2021-09-24",
"update_date": "2023-08-29",
"expiry_date": "2025-09-24",
"registrar_name": "Ikiji Ltd t/a Ikiji [Tag = IKIJI]",
"registrar_website": "https://portal.ikiji.com",
"name_servers": [
"ns1.ikiji.com",
"ns2.ikiji.com",
"ns3.ikiji.com"
],
"domain_status": [
"Registered until expiry date."
]
},
{
"num": 82,
"domain_name": "stingteam.co.uk",
"domain_keyword": "stingteam",
"domain_tld": "co.uk",
"query_time": "2024-03-30 04:00:55",
"create_date": "2023-09-24",
"update_date": "2023-12-10",
"expiry_date": "2025-09-24",
"registrar_name": "123-Reg Limited t/a 123-reg [Tag = 123-REG]",
"registrar_website": "https://www.123-reg.co.uk",
"name_servers": [
"ns45.domaincontrol.com",
"ns46.domaincontrol.com"
],
"domain_status": [
"Registered until expiry date."
]
},
{
"num": 83,
"domain_name": "brandicarrfarm.co.uk",
"domain_keyword": "brandicarrfarm",
"domain_tld": "co.uk",
"query_time": "2024-03-30 05:51:15",
"create_date": "2019-09-24",
"update_date": "2023-08-25",
"expiry_date": "2025-09-24",
"registrar_name": "Fasthosts Internet Ltd [Tag = LIVEDOMAINS]",
"registrar_website": "http://www.fasthosts.co.uk",
"name_servers": [
"ns1.livedns.co.uk",
"ns2.livedns.co.uk",
"ns3.livedns.co.uk"
],
"domain_status": [
"Registered until expiry date."
]
},
{
"num": 84,
"domain_name": "o1om.co.uk",
"domain_keyword": "o1om",
"domain_tld": "co.uk",
"query_time": "2024-03-30 13:03:01",
"create_date": "2023-09-24",
"update_date": "2023-09-24",
"expiry_date": "2025-09-24",
"registrar_name": "Fasthosts Internet Ltd [Tag = LIVEDOMAINS]",
"registrar_website": "http://www.fasthosts.co.uk",
"name_servers": [
"ns1.livedns.co.uk",
"ns2.livedns.co.uk",
"ns3.livedns.co.uk"
],
"domain_status": [
"Registered until expiry date."
]
},
{
"num": 85,
"domain_name": "cookiegirl.co.uk",
"domain_keyword": "cookiegirl",
"domain_tld": "co.uk",
"query_time": "2024-03-30 13:44:19",
"create_date": "2004-09-24",
"update_date": "2023-06-22",
"expiry_date": "2025-09-24",
"registrar_name": "Ionos SE [Tag = 1AND1]",
"registrar_website": "https://ionos.com",
"name_servers": [
"ns1070.ui-dns.biz",
"ns1070.ui-dns.com",
"ns1070.ui-dns.de",
"ns1070.ui-dns.org"
],
"domain_status": [
"Registered until expiry date."
]
},
{
"num": 86,
"domain_name": "hazlieburn.co.uk",
"domain_keyword": "hazlieburn",
"domain_tld": "co.uk",
"query_time": "2024-03-30 16:56:06",
"create_date": "2021-09-24",
"update_date": "2023-08-29",
"expiry_date": "2025-09-24",
"registrar_name": "Fasthosts Internet Ltd [Tag = LIVEDOMAINS]",
"registrar_website": "http://www.fasthosts.co.uk",
"name_servers": [
"ns1.livedns.co.uk",
"ns2.livedns.co.uk",
"ns3.livedns.co.uk"
],
"domain_status": [
"Registered until expiry date."
]
},
{
"num": 87,
"domain_name": "bartlomiejsienkiewicz.pl",
"domain_keyword": "bartlomiejsienkiewicz",
"domain_tld": "pl",
"query_time": "2024-03-31 02:14:16",
"create_date": "2018-09-24",
"update_date": "2023-09-25",
"expiry_date": "2025-09-24",
"registrar_name": "OVH SAS",
"registrar_website": "https://www.ovhcloud.com",
"name_servers": [
"dns112.ovh.net",
"ns112.ovh.net"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 88,
"domain_name": "londonfunctionalmedics.co.uk",
"domain_keyword": "londonfunctionalmedics",
"domain_tld": "co.uk",
"query_time": "2024-04-01 02:52:04",
"create_date": "2023-09-24",
"update_date": "2023-12-20",
"expiry_date": "2025-09-24",
"registrar_name": "123-Reg Limited t/a 123-reg [Tag = 123-REG]",
"registrar_website": "https://www.123-reg.co.uk",
"name_servers": [
"ns13.domaincontrol.com",
"ns14.domaincontrol.com"
],
"domain_status": [
"Registered until expiry date."
]
},
{
"num": 89,
"domain_name": "londoninternationalrallye.uk",
"domain_keyword": "londoninternationalrallye",
"domain_tld": "uk",
"query_time": "2024-04-01 02:53:24",
"create_date": "2023-09-24",
"update_date": "2023-09-24",
"expiry_date": "2025-09-24",
"registrar_name": "GoDaddy.com, LLC. [Tag = GODADDY]",
"registrar_website": "http://uk.godaddy.com",
"name_servers": [
"ns45.domaincontrol.com",
"ns46.domaincontrol.com"
],
"domain_status": [
"Registered until expiry date."
]
},
{
"num": 90,
"domain_name": "evolvefamily.co.uk",
"domain_keyword": "evolvefamily",
"domain_tld": "co.uk",
"query_time": "2024-04-01 03:11:46",
"create_date": "2015-09-24",
"update_date": "2023-08-25",
"expiry_date": "2025-09-24",
"registrar_name": "Fasthosts Internet Ltd [Tag = LIVEDOMAINS]",
"registrar_website": "http://www.fasthosts.co.uk",
"name_servers": [
"ns1.livedns.co.uk",
"ns2.livedns.co.uk",
"ns3.livedns.co.uk"
],
"domain_status": [
"Registered until expiry date."
]
},
{
"num": 91,
"domain_name": "mellors.me.uk",
"domain_keyword": "mellors",
"domain_tld": "me.uk",
"query_time": "2024-04-01 09:31:26",
"create_date": "2009-09-24",
"update_date": "2023-09-23",
"expiry_date": "2025-09-24",
"registrar_name": "Ionos SE [Tag = 1AND1]",
"registrar_website": "https://ionos.com",
"name_servers": [
"ns1055.ui-dns.biz",
"ns1055.ui-dns.com",
"ns1055.ui-dns.de",
"ns1055.ui-dns.org"
],
"domain_status": [
"Registered until expiry date."
]
},
{
"num": 92,
"domain_name": "stjamesconservation.co.uk",
"domain_keyword": "stjamesconservation",
"domain_tld": "co.uk",
"query_time": "2024-04-01 10:42:46",
"create_date": "2015-09-24",
"update_date": "2023-12-05",
"expiry_date": "2025-09-24",
"registrar_name": "123-Reg Limited t/a 123-reg [Tag = 123-REG]",
"registrar_website": "https://www.123-reg.co.uk",
"name_servers": [
"ns55.domaincontrol.com",
"ns56.domaincontrol.com"
],
"domain_status": [
"Registered until expiry date."
]
},
{
"num": 93,
"domain_name": "crescent-grove.co.uk",
"domain_keyword": "crescent-grove",
"domain_tld": "co.uk",
"query_time": "2024-04-01 11:32:15",
"create_date": "2019-09-24",
"update_date": "2023-09-25",
"expiry_date": "2025-09-24",
"registrar_name": "GoDaddy.com, LLC. [Tag = GODADDY]",
"registrar_website": "http://uk.godaddy.com",
"name_servers": [
"ns19.domaincontrol.com",
"ns20.domaincontrol.com"
],
"domain_status": [
"Registered until expiry date."
]
},
{
"num": 94,
"domain_name": "hiszpanskiodreki.pl",
"domain_keyword": "hiszpanskiodreki",
"domain_tld": "pl",
"query_time": "2024-04-01 14:00:50",
"create_date": "2017-09-24",
"update_date": "2024-03-08",
"expiry_date": "2025-09-24",
"registrar_name": "home.pl S.A.",
"registrar_website": "https://home.pl/kontakt",
"name_servers": [
"dns.home.pl",
"dns2.home.pl",
"dns3.home.pl"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 95,
"domain_name": "dalintobertrading.co.uk",
"domain_keyword": "dalintobertrading",
"domain_tld": "co.uk",
"query_time": "2024-04-01 17:02:05",
"create_date": "2021-09-24",
"update_date": "2023-09-25",
"expiry_date": "2025-09-24",
"registrar_name": "GoDaddy.com, LLC. [Tag = GODADDY]",
"registrar_website": "http://uk.godaddy.com",
"name_servers": [
"ns49.domaincontrol.com",
"ns50.domaincontrol.com"
],
"domain_status": [
"Registered until expiry date."
]
},
{
"num": 96,
"domain_name": "brilliantroom.co.uk",
"domain_keyword": "brilliantroom",
"domain_tld": "co.uk",
"query_time": "2024-04-01 17:23:30",
"create_date": "2003-09-24",
"update_date": "2023-09-24",
"expiry_date": "2025-09-24",
"registrar_name": "LCN.com Ltd [Tag = LCN]",
"registrar_website": "http://www.lcn.com",
"name_servers": [
"ns0.lcn.com",
"ns1.lcn.com",
"ns2.lcn.com"
],
"domain_status": [
"Registered until expiry date."
]
},
{
"num": 97,
"domain_name": "fizjolangchlasta.pl",
"domain_keyword": "fizjolangchlasta",
"domain_tld": "pl",
"query_time": "2024-04-01 19:01:58",
"create_date": "2021-09-24",
"update_date": "2023-09-05",
"expiry_date": "2025-09-24",
"registrar_name": "Hosting Concepts B.V.",
"name_servers": [
"ns1.dns-parking.com",
"ns2.dns-parking.com"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 98,
"domain_name": "yarnandsinker.co.uk",
"domain_keyword": "yarnandsinker",
"domain_tld": "co.uk",
"query_time": "2024-04-01 23:36:58",
"create_date": "2023-09-24",
"update_date": "2023-09-24",
"expiry_date": "2025-09-24",
"registrar_name": "20i Ltd [Tag = STACK]",
"registrar_website": "http://www.20i.com",
"name_servers": [
"ns1.stackdns.com",
"ns2.stackdns.com",
"ns3.stackdns.com",
"ns4.stackdns.com"
],
"domain_status": [
"Registered until expiry date."
]
},
{
"num": 99,
"domain_name": "bijawellness.co.uk",
"domain_keyword": "bijawellness",
"domain_tld": "co.uk",
"query_time": "2024-04-02 00:08:19",
"create_date": "2023-09-24",
"update_date": "2023-12-10",
"expiry_date": "2025-09-24",
"registrar_name": "123-Reg Limited t/a 123-reg [Tag = 123-REG]",
"registrar_website": "https://www.123-reg.co.uk",
"name_servers": [
"ns23.domaincontrol.com",
"ns24.domaincontrol.com"
],
"domain_status": [
"Registered until expiry date."
]
},
{
"num": 100,
"domain_name": "bijawellbeing.co.uk",
"domain_keyword": "bijawellbeing",
"domain_tld": "co.uk",
"query_time": "2024-04-02 00:08:19",
"create_date": "2023-09-24",
"update_date": "2023-12-10",
"expiry_date": "2025-09-24",
"registrar_name": "123-Reg Limited t/a 123-reg [Tag = 123-REG]",
"registrar_website": "https://www.123-reg.co.uk",
"name_servers": [
"ns51.domaincontrol.com",
"ns52.domaincontrol.com"
],
"domain_status": [
"Registered until expiry date."
]
}
],
"search_after": "1712016499000_15627",
"stats": {
"total_time": 0.59,
"api_credits_used": 1,
"cost_calculation": "1 (search_fields[expiry_date])"
}
}<root>
<success>true</success>
<query>
<database>current</database>
<expiry_date>2025-09-24</expiry_date>
<sort_by>query_time</sort_by>
<sort_order>asc</sort_order>
<page_size>100</page_size>
</query>
<count>
<total>10000</total>
<relation>gte</relation>
<current>100</current>
</count>
<unique_domains>vilpetrus.kred, xn--fiqs8sfmo4c.xn--czr694b, xn--lsv1b.xn--czr694b, wakeup.xn--czr694b, doublemen.xn--czr694b, xn--sjq02jxqv.xn--czr694b, xn--w4ry5ksq9a.xn--czr694b, xn--fiqw8jhwbfytj5i07a.xn--czr694b, xn--fiq7v14hnby2jsv9fpm8a.xn--czr694b, xn--kbtpt25t5v0arlt.xn--czr694b, xn--cks9z47i.xn--czr694b, xn--czru2dgwx4c.xn--czr694b, xn--fiq7v14hea82wbz6b.xn--czr694b, xn--fiq33nnlt0da782x34pus4a0f1b.xn--czr694b, aojo.xn--czr694b, xn--gmq302a.xn--czr694b, xn--kbtt0zfcr82j.xn--czr694b, xn--czru2dy5fr2l4s9c.xn--czr694b, xn--7py627c.xn--czr694b, compusales.com.mx, watertreatment.co.id, ipdisk.co.kr, sidomuncul.co.id, fpe-sbsi.or.id, lakes.co.id, pavingblock.co.id, microdam.co.kr, kalitest.co.kr, nasos.uz, hbtec.kr, fusion.mn, uspk.or.kr, miryangcc.co.kr, allogin.co.kr, icaritas.or.kr, ochairs.co.kr, okkosher.co.kr, academyinfo.kr, myco.gi, mistwear.pl, styl-projekt.pl, klimatech-glogow.pl, stomatologia-jaworzynka.pl, el-par.pl, frankfurt.pl, ekontenery.pl, silniki-zem.pl, sppl.pl, naszortodonta.pl, komat.net.pl, tartaksapula.pl, altergeo.pl, kancelariakredytywefrankach.pl, wszystkodlabiura.pl, viverno.pl, ryczace20.pl, najprzystojniejszy.pl, energiadom.pl, fitamina.pl, medi-car.pl, biokompostownia.pl, pracowniczenoclegi.pl, gwps.pl, slodkachwila.pl, hotelregent.pl, kredyty-opole.pl, stylowniawnetrz.pl, estromed.pl, oskextreme.pl, mediabrokergroup.pl, gminajaslo.pl, longniddryinn.co.uk, leszcz.uk, szpital-braniewo.pl, annagilewska.pl, palacradomilow.pl, wns.pl, thegardenapartment.co.uk, survey.pl, polna.com.pl, doublegoldcoaching.co.uk, stingteam.co.uk, brandicarrfarm.co.uk, o1om.co.uk, cookiegirl.co.uk, hazlieburn.co.uk, bartlomiejsienkiewicz.pl, londonfunctionalmedics.co.uk, londoninternationalrallye.uk, evolvefamily.co.uk, mellors.me.uk, stjamesconservation.co.uk, crescent-grove.co.uk, hiszpanskiodreki.pl, dalintobertrading.co.uk, brilliantroom.co.uk, fizjolangchlasta.pl, yarnandsinker.co.uk, bijawellness.co.uk, bijawellbeing.co.uk</unique_domains>
<results>
<value>
<num>1</num>
<domain_name>vilpetrus.kred</domain_name>
<domain_keyword>vilpetrus</domain_keyword>
<domain_tld>kred</domain_tld>
<query_time>2015-09-25 00:00:00</query_time>
<create_date>2015-09-25</create_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_iana>1731</registrar_iana>
<registrar_name>TLD Registrar Pty Ltd</registrar_name>
<registrant_name>Michael Deparini</registrant_name>
<registrant_company>KredTLD Pty Ltd</registrant_company>
<registrant_address>322/5 Lime St</registrant_address>
<registrant_city>Sydney</registrant_city>
<registrant_state>NSW</registrant_state>
<registrant_zip>2000</registrant_zip>
<registrant_country>AU</registrant_country>
<registrant_email>[email protected]</registrant_email>
<registrant_phone>61292990499</registrant_phone>
<name_servers>
<value>ns-1431.awsdns-50.org</value>
<value>ns-1624.awsdns-11.co.uk</value>
<value>ns-367.awsdns-45.com</value>
<value>ns-685.awsdns-21.net</value>
</name_servers>
<domain_status>
<value>ok</value>
</domain_status>
</value>
<value>
<num>2</num>
<domain_name>xn--fiqs8sfmo4c.xn--czr694b</domain_name>
<domain_keyword>xn--fiqs8sfmo4c</domain_keyword>
<domain_tld>xn--czr694b</domain_tld>
<query_time>2015-09-26 00:00:00</query_time>
<create_date>2015-09-24</create_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_iana>1925</registrar_iana>
<registrar_name>Guangdong HUYI Internet & IP Services Co.,Ltd</registrar_name>
<registrant_name>????????????</registrant_name>
<registrant_company>????????????</registrant_company>
<registrant_address>7/F, Chinachem Century Tower, No. 178 Gloucester Road, Wanchai,Hong Kong.</registrant_address>
<registrant_city>??</registrant_city>
<registrant_state>??</registrant_state>
<registrant_country>CN</registrant_country>
<registrant_email>[email protected]</registrant_email>
<registrant_phone>864006281118</registrant_phone>
<name_servers>
<value>ns1.8hy.cn</value>
<value>ns2.8hy.cn</value>
</name_servers>
<domain_status>
<value>ok</value>
</domain_status>
</value>
<value>
<num>3</num>
<domain_name>xn--lsv1b.xn--czr694b</domain_name>
<domain_keyword>xn--lsv1b</domain_keyword>
<domain_tld>xn--czr694b</domain_tld>
<query_time>2015-09-26 00:00:00</query_time>
<create_date>2015-09-24</create_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_iana>1925</registrar_iana>
<registrar_name>Guangdong HUYI Internet & IP Services Co.,Ltd</registrar_name>
<registrant_name>????????????</registrant_name>
<registrant_company>????????????</registrant_company>
<registrant_address>7/F, Chinachem Century Tower, No. 178 Gloucester Road, Wanchai,Hong Kong.</registrant_address>
<registrant_city>??</registrant_city>
<registrant_state>??</registrant_state>
<registrant_country>CN</registrant_country>
<registrant_email>[email protected]</registrant_email>
<registrant_phone>864006281118</registrant_phone>
<name_servers>
<value>ns1.8hy.cn</value>
<value>ns2.8hy.cn</value>
</name_servers>
<domain_status>
<value>ok</value>
</domain_status>
</value>
<value>
<num>4</num>
<domain_name>wakeup.xn--czr694b</domain_name>
<domain_keyword>wakeup</domain_keyword>
<domain_tld>xn--czr694b</domain_tld>
<query_time>2015-09-26 00:00:00</query_time>
<create_date>2015-09-24</create_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_iana>1481</registrar_iana>
<registrar_name>Hu Yi Global Information Hong Kong Limited</registrar_name>
<registrant_name>???</registrant_name>
<registrant_company>????????</registrant_company>
<registrant_address>7/F, Chinachem Century Tower, No. 178 Gloucester Road, Wanchai,Hong Kong.</registrant_address>
<registrant_city>??</registrant_city>
<registrant_state>??</registrant_state>
<registrant_country>CN</registrant_country>
<registrant_email>[email protected]</registrant_email>
<registrant_phone>864006281118</registrant_phone>
<name_servers>
<value>ns1.8hy.cn</value>
<value>ns2.8hy.cn</value>
</name_servers>
<domain_status>
<value>ok</value>
</domain_status>
</value>
<value>
<num>5</num>
<domain_name>doublemen.xn--czr694b</domain_name>
<domain_keyword>doublemen</domain_keyword>
<domain_tld>xn--czr694b</domain_tld>
<query_time>2015-09-26 00:00:00</query_time>
<create_date>2015-09-24</create_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_iana>1481</registrar_iana>
<registrar_name>Hu Yi Global Information Hong Kong Limited</registrar_name>
<registrant_name>KWONG SHING TRADING AS SEE CHEONG GARMENT FTY</registrant_name>
<registrant_company>KWONG SHING TRADING AS SEE CHEONG GARMENT FTY</registrant_company>
<registrant_address>7TH FLOOR, 1139 YIP KWONG INDUSTRIAL BUILDING, CANTON ROAD, MONGKOK, KOWLOON, HONG KONG</registrant_address>
<registrant_city>HK</registrant_city>
<registrant_zip>123456</registrant_zip>
<registrant_country>HK</registrant_country>
<registrant_email>[email protected]</registrant_email>
<registrant_phone>85223942449</registrant_phone>
<registrant_fax>8623970161</registrant_fax>
<name_servers>
<value>ns1.8hy.hk</value>
<value>ns2.8hy.hk</value>
</name_servers>
<domain_status>
<value>ok</value>
</domain_status>
</value>
<value>
<num>6</num>
<domain_name>xn--sjq02jxqv.xn--czr694b</domain_name>
<domain_keyword>xn--sjq02jxqv</domain_keyword>
<domain_tld>xn--czr694b</domain_tld>
<query_time>2015-09-26 00:00:00</query_time>
<create_date>2015-09-24</create_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_iana>1481</registrar_iana>
<registrar_name>Hu Yi Global Information Hong Kong Limited</registrar_name>
<registrant_name>???</registrant_name>
<registrant_company>????????</registrant_company>
<registrant_address>7/F, Chinachem Century Tower, No. 178 Gloucester Road, Wanchai,Hong Kong.</registrant_address>
<registrant_city>??</registrant_city>
<registrant_state>??</registrant_state>
<registrant_country>CN</registrant_country>
<registrant_email>[email protected]</registrant_email>
<registrant_phone>864006281118</registrant_phone>
<name_servers>
<value>ns1.8hy.cn</value>
<value>ns2.8hy.cn</value>
</name_servers>
<domain_status>
<value>ok</value>
</domain_status>
</value>
<value>
<num>7</num>
<domain_name>xn--w4ry5ksq9a.xn--czr694b</domain_name>
<domain_keyword>xn--w4ry5ksq9a</domain_keyword>
<domain_tld>xn--czr694b</domain_tld>
<query_time>2015-09-26 00:00:00</query_time>
<create_date>2015-09-24</create_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_iana>1925</registrar_iana>
<registrar_name>Guangdong HUYI Internet & IP Services Co.,Ltd</registrar_name>
<registrant_name>??????????????</registrant_name>
<registrant_company>??????????????</registrant_company>
<registrant_address>7/F, Chinachem Century Tower, No. 178 Gloucester Road, Wanchai,Hong Kong.</registrant_address>
<registrant_city>??</registrant_city>
<registrant_state>??</registrant_state>
<registrant_country>CN</registrant_country>
<registrant_email>[email protected]</registrant_email>
<registrant_phone>864006281118</registrant_phone>
<name_servers>
<value>ns1.8hy.cn</value>
<value>ns2.8hy.cn</value>
</name_servers>
<domain_status>
<value>ok</value>
</domain_status>
</value>
<value>
<num>8</num>
<domain_name>xn--fiqw8jhwbfytj5i07a.xn--czr694b</domain_name>
<domain_keyword>xn--fiqw8jhwbfytj5i07a</domain_keyword>
<domain_tld>xn--czr694b</domain_tld>
<query_time>2015-09-26 00:00:00</query_time>
<create_date>2015-09-24</create_date>
<update_date>2015-09-25</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_iana>1925</registrar_iana>
<registrar_name>Guangdong HUYI Internet & IP Services Co.,Ltd</registrar_name>
<registrant_name>??????</registrant_name>
<registrant_company>??????</registrant_company>
<registrant_address>7/F, Chinachem Century Tower, No. 178 Gloucester Road, Wanchai,Hong Kong.</registrant_address>
<registrant_city>??</registrant_city>
<registrant_state>??</registrant_state>
<registrant_country>CN</registrant_country>
<registrant_email>[email protected]</registrant_email>
<registrant_phone>864006281118</registrant_phone>
<name_servers>
<value>ns1.8hy.cn</value>
<value>ns2.8hy.cn</value>
</name_servers>
<domain_status>
<value>ok</value>
</domain_status>
</value>
<value>
<num>9</num>
<domain_name>xn--fiq7v14hnby2jsv9fpm8a.xn--czr694b</domain_name>
<domain_keyword>xn--fiq7v14hnby2jsv9fpm8a</domain_keyword>
<domain_tld>xn--czr694b</domain_tld>
<query_time>2015-09-26 00:00:00</query_time>
<create_date>2015-09-24</create_date>
<update_date>2015-09-25</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_iana>1925</registrar_iana>
<registrar_name>Guangdong HUYI Internet & IP Services Co.,Ltd</registrar_name>
<registrant_name>??????</registrant_name>
<registrant_company>??????</registrant_company>
<registrant_address>7/F, Chinachem Century Tower, No. 178 Gloucester Road, Wanchai,Hong Kong.</registrant_address>
<registrant_city>??</registrant_city>
<registrant_state>??</registrant_state>
<registrant_country>CN</registrant_country>
<registrant_email>[email protected]</registrant_email>
<registrant_phone>864006281118</registrant_phone>
<name_servers>
<value>ns1.8hy.cn</value>
<value>ns2.8hy.cn</value>
</name_servers>
<domain_status>
<value>ok</value>
</domain_status>
</value>
<value>
<num>10</num>
<domain_name>xn--kbtpt25t5v0arlt.xn--czr694b</domain_name>
<domain_keyword>xn--kbtpt25t5v0arlt</domain_keyword>
<domain_tld>xn--czr694b</domain_tld>
<query_time>2015-09-26 00:00:00</query_time>
<create_date>2015-09-24</create_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_iana>1925</registrar_iana>
<registrar_name>Guangdong HUYI Internet & IP Services Co.,Ltd</registrar_name>
<registrant_name>???????(??)????</registrant_name>
<registrant_company>???????(??)????</registrant_company>
<registrant_address>7/F, Chinachem Century Tower, No. 178 Gloucester Road, Wanchai,Hong Kong.</registrant_address>
<registrant_city>??</registrant_city>
<registrant_state>??</registrant_state>
<registrant_country>CN</registrant_country>
<registrant_email>[email protected]</registrant_email>
<registrant_phone>864006281118</registrant_phone>
<name_servers>
<value>ns1.8hy.cn</value>
<value>ns2.8hy.cn</value>
</name_servers>
<domain_status>
<value>ok</value>
</domain_status>
</value>
<value>
<num>11</num>
<domain_name>xn--cks9z47i.xn--czr694b</domain_name>
<domain_keyword>xn--cks9z47i</domain_keyword>
<domain_tld>xn--czr694b</domain_tld>
<query_time>2015-09-26 00:00:00</query_time>
<create_date>2015-09-24</create_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_iana>1925</registrar_iana>
<registrar_name>Guangdong HUYI Internet & IP Services Co.,Ltd</registrar_name>
<registrant_name>???</registrant_name>
<registrant_company>??????????????</registrant_company>
<registrant_address>7/F, Chinachem Century Tower, No. 178 Gloucester Road, Wanchai,Hong Kong.</registrant_address>
<registrant_city>??</registrant_city>
<registrant_state>??</registrant_state>
<registrant_country>CN</registrant_country>
<registrant_email>[email protected]</registrant_email>
<registrant_phone>864006281118</registrant_phone>
<name_servers>
<value>ns1.8hy.cn</value>
<value>ns2.8hy.cn</value>
</name_servers>
<domain_status>
<value>ok</value>
</domain_status>
</value>
<value>
<num>12</num>
<domain_name>xn--czru2dgwx4c.xn--czr694b</domain_name>
<domain_keyword>xn--czru2dgwx4c</domain_keyword>
<domain_tld>xn--czr694b</domain_tld>
<query_time>2015-09-26 00:00:00</query_time>
<create_date>2015-09-24</create_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_iana>1925</registrar_iana>
<registrar_name>Guangdong HUYI Internet & IP Services Co.,Ltd</registrar_name>
<registrant_name>????????????</registrant_name>
<registrant_company>????????????</registrant_company>
<registrant_address>7/F, Chinachem Century Tower, No. 178 Gloucester Road, Wanchai,Hong Kong.</registrant_address>
<registrant_city>??</registrant_city>
<registrant_state>??</registrant_state>
<registrant_country>CN</registrant_country>
<registrant_email>[email protected]</registrant_email>
<registrant_phone>864006281118</registrant_phone>
<name_servers>
<value>ns1.8hy.cn</value>
<value>ns2.8hy.cn</value>
</name_servers>
<domain_status>
<value>ok</value>
</domain_status>
</value>
<value>
<num>13</num>
<domain_name>xn--fiq7v14hea82wbz6b.xn--czr694b</domain_name>
<domain_keyword>xn--fiq7v14hea82wbz6b</domain_keyword>
<domain_tld>xn--czr694b</domain_tld>
<query_time>2015-09-26 00:00:00</query_time>
<create_date>2015-09-24</create_date>
<update_date>2015-09-25</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_iana>1925</registrar_iana>
<registrar_name>Guangdong HUYI Internet & IP Services Co.,Ltd</registrar_name>
<registrant_name>??????</registrant_name>
<registrant_company>??????</registrant_company>
<registrant_address>7/F, Chinachem Century Tower, No. 178 Gloucester Road, Wanchai,Hong Kong.</registrant_address>
<registrant_city>??</registrant_city>
<registrant_state>??</registrant_state>
<registrant_country>CN</registrant_country>
<registrant_email>[email protected]</registrant_email>
<registrant_phone>864006281118</registrant_phone>
<name_servers>
<value>ns1.8hy.cn</value>
<value>ns2.8hy.cn</value>
</name_servers>
<domain_status>
<value>ok</value>
</domain_status>
</value>
<value>
<num>14</num>
<domain_name>xn--fiq33nnlt0da782x34pus4a0f1b.xn--czr694b</domain_name>
<domain_keyword>xn--fiq33nnlt0da782x34pus4a0f1b</domain_keyword>
<domain_tld>xn--czr694b</domain_tld>
<query_time>2015-09-26 00:00:00</query_time>
<create_date>2015-09-24</create_date>
<update_date>2015-09-25</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_iana>1925</registrar_iana>
<registrar_name>Guangdong HUYI Internet & IP Services Co.,Ltd</registrar_name>
<registrant_name>??????</registrant_name>
<registrant_company>??????</registrant_company>
<registrant_address>7/F, Chinachem Century Tower, No. 178 Gloucester Road, Wanchai,Hong Kong.</registrant_address>
<registrant_city>??</registrant_city>
<registrant_state>??</registrant_state>
<registrant_country>CN</registrant_country>
<registrant_email>[email protected]</registrant_email>
<registrant_phone>864006281118</registrant_phone>
<name_servers>
<value>ns1.8hy.cn</value>
<value>ns2.8hy.cn</value>
</name_servers>
<domain_status>
<value>ok</value>
</domain_status>
</value>
<value>
<num>15</num>
<domain_name>aojo.xn--czr694b</domain_name>
<domain_keyword>aojo</domain_keyword>
<domain_tld>xn--czr694b</domain_tld>
<query_time>2015-09-26 00:00:00</query_time>
<create_date>2015-09-24</create_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_iana>1481</registrar_iana>
<registrar_name>Hu Yi Global Information Hong Kong Limited</registrar_name>
<registrant_name>??</registrant_name>
<registrant_company>??</registrant_company>
<registrant_address>7/F, Chinachem Century Tower, No. 178 Gloucester Road, Wanchai,Hong Kong.</registrant_address>
<registrant_city>??</registrant_city>
<registrant_state>??</registrant_state>
<registrant_country>CN</registrant_country>
<registrant_email>[email protected]</registrant_email>
<registrant_phone>864006281118</registrant_phone>
<name_servers>
<value>ns1.8hy.cn</value>
<value>ns2.8hy.cn</value>
</name_servers>
<domain_status>
<value>ok</value>
</domain_status>
</value>
<value>
<num>16</num>
<domain_name>xn--gmq302a.xn--czr694b</domain_name>
<domain_keyword>xn--gmq302a</domain_keyword>
<domain_tld>xn--czr694b</domain_tld>
<query_time>2015-09-26 00:00:00</query_time>
<create_date>2015-09-24</create_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_iana>1481</registrar_iana>
<registrar_name>Hu Yi Global Information Hong Kong Limited</registrar_name>
<registrant_name>KWONG OI WAN KATHY</registrant_name>
<registrant_company>KWONG OI WAN KATHY</registrant_company>
<registrant_address>7TH FLOOR, 1139 YIP KWONG INDUSTRIAL BUILDING, CANTON ROAD, MONGKOK, KOWLOON, HONG KONG</registrant_address>
<registrant_city>HK</registrant_city>
<registrant_zip>123456</registrant_zip>
<registrant_country>HK</registrant_country>
<registrant_email>[email protected]</registrant_email>
<registrant_phone>85223942449</registrant_phone>
<registrant_fax>8623970161</registrant_fax>
<name_servers>
<value>ns1.8hy.hk</value>
<value>ns2.8hy.hk</value>
</name_servers>
<domain_status>
<value>ok</value>
</domain_status>
</value>
<value>
<num>17</num>
<domain_name>xn--kbtt0zfcr82j.xn--czr694b</domain_name>
<domain_keyword>xn--kbtt0zfcr82j</domain_keyword>
<domain_tld>xn--czr694b</domain_tld>
<query_time>2015-09-26 00:00:00</query_time>
<create_date>2015-09-24</create_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_iana>1925</registrar_iana>
<registrar_name>Guangdong HUYI Internet & IP Services Co.,Ltd</registrar_name>
<registrant_name>????????????</registrant_name>
<registrant_company>????????????</registrant_company>
<registrant_address>7/F, Chinachem Century Tower, No. 178 Gloucester Road, Wanchai,Hong Kong.</registrant_address>
<registrant_city>??</registrant_city>
<registrant_state>??</registrant_state>
<registrant_country>CN</registrant_country>
<registrant_email>[email protected]</registrant_email>
<registrant_phone>864006281118</registrant_phone>
<name_servers>
<value>ns1.8hy.cn</value>
<value>ns2.8hy.cn</value>
</name_servers>
<domain_status>
<value>ok</value>
</domain_status>
</value>
<value>
<num>18</num>
<domain_name>xn--czru2dy5fr2l4s9c.xn--czr694b</domain_name>
<domain_keyword>xn--czru2dy5fr2l4s9c</domain_keyword>
<domain_tld>xn--czr694b</domain_tld>
<query_time>2015-09-26 00:00:00</query_time>
<create_date>2015-09-24</create_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_iana>1925</registrar_iana>
<registrar_name>Guangdong HUYI Internet & IP Services Co.,Ltd</registrar_name>
<registrant_name>???????(??)????</registrant_name>
<registrant_company>???????(??)????</registrant_company>
<registrant_address>7/F, Chinachem Century Tower, No. 178 Gloucester Road, Wanchai,Hong Kong.</registrant_address>
<registrant_city>??</registrant_city>
<registrant_state>??</registrant_state>
<registrant_country>CN</registrant_country>
<registrant_email>[email protected]</registrant_email>
<registrant_phone>864006281118</registrant_phone>
<name_servers>
<value>ns1.8hy.cn</value>
<value>ns2.8hy.cn</value>
</name_servers>
<domain_status>
<value>ok</value>
</domain_status>
</value>
<value>
<num>19</num>
<domain_name>xn--7py627c.xn--czr694b</domain_name>
<domain_keyword>xn--7py627c</domain_keyword>
<domain_tld>xn--czr694b</domain_tld>
<query_time>2015-10-09 00:00:00</query_time>
<create_date>2015-09-24</create_date>
<update_date>2015-10-08</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_iana>1925</registrar_iana>
<registrar_name>Guangdong HUYI Internet & IP Services Co.,Ltd</registrar_name>
<registrant_name>??????????</registrant_name>
<registrant_company>??????????</registrant_company>
<registrant_address>7/F, Chinachem Century Tower, No. 178 Gloucester Road, Wanchai,Hong Kong.</registrant_address>
<registrant_city>??</registrant_city>
<registrant_state>??</registrant_state>
<registrant_country>CN</registrant_country>
<registrant_email>[email protected]</registrant_email>
<registrant_phone>864006281118</registrant_phone>
<name_servers>
<value>ns1.8hy.cn</value>
<value>ns2.8hy.cn</value>
</name_servers>
<domain_status>
<value>ok</value>
</domain_status>
</value>
<value>
<num>20</num>
<domain_name>compusales.com.mx</domain_name>
<domain_keyword>compusales</domain_keyword>
<domain_tld>com.mx</domain_tld>
<query_time>2017-04-08 15:57:34</query_time>
<create_date>2002-09-25</create_date>
<update_date>2016-09-09</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>Akky (Una division de NIC Mexico)</registrar_name>
<registrant_name>COMPUSALES DE MEXICO S.A DE C.V</registrant_name>
<registrant_city>MEXICO</registrant_city>
<registrant_state>Distrito Federal</registrant_state>
<registrant_country>MX</registrant_country>
<name_servers>
<value>ns1.compusales.com.mx</value>
<value>ns2.compusales.com.mx</value>
</name_servers>
</value>
<value>
<num>21</num>
<domain_name>watertreatment.co.id</domain_name>
<domain_keyword>watertreatment</domain_keyword>
<domain_tld>co.id</domain_tld>
<query_time>2018-10-09 02:47:48</query_time>
<create_date>2013-09-24</create_date>
<update_date>2018-08-30</update_date>
<expiry_date>2025-09-24</expiry_date>
<domain_status>
<value>clientTransferProhibited</value>
<value>serverTransferProhibited</value>
</domain_status>
</value>
<value>
<num>22</num>
<domain_name>ipdisk.co.kr</domain_name>
<domain_keyword>ipdisk</domain_keyword>
<domain_tld>co.kr</domain_tld>
<query_time>2021-03-27 08:03:34</query_time>
<create_date>2010-09-24</create_date>
<update_date>2020-05-07</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>(?)?????</registrar_name>
<registrar_website>http://www.inames.co.kr</registrar_website>
<registrant_name>(?)????????</registrant_name>
<registrant_address>??? ??? ??? ??? 15 ????2 ?? 6? 6th Floor Benposra II B/D, 15 Jukjeon-ro Giheung-gu Yongin-si, Gyeonggi-do, KR</registrant_address>
<registrant_zip>16897</registrant_zip>
</value>
<value>
<num>23</num>
<domain_name>sidomuncul.co.id</domain_name>
<domain_keyword>sidomuncul</domain_keyword>
<domain_tld>co.id</domain_tld>
<query_time>2021-12-13 04:31:28</query_time>
<create_date>2013-09-24</create_date>
<update_date>2020-07-24</update_date>
<expiry_date>2025-09-24</expiry_date>
<domain_status>
<value>clientTransferProhibited</value>
</domain_status>
</value>
<value>
<num>24</num>
<domain_name>fpe-sbsi.or.id</domain_name>
<domain_keyword>fpe-sbsi</domain_keyword>
<domain_tld>or.id</domain_tld>
<query_time>2022-06-08 16:38:32</query_time>
<create_date>2012-09-24</create_date>
<update_date>2022-02-17</update_date>
<expiry_date>2025-09-24</expiry_date>
<domain_status>
<value>ok</value>
</domain_status>
</value>
<value>
<num>25</num>
<domain_name>lakes.co.id</domain_name>
<domain_keyword>lakes</domain_keyword>
<domain_tld>co.id</domain_tld>
<query_time>2022-06-11 17:36:29</query_time>
<create_date>2019-09-24</create_date>
<update_date>2020-07-25</update_date>
<expiry_date>2025-09-24</expiry_date>
<domain_status>
<value>ok</value>
</domain_status>
</value>
<value>
<num>26</num>
<domain_name>pavingblock.co.id</domain_name>
<domain_keyword>pavingblock</domain_keyword>
<domain_tld>co.id</domain_tld>
<query_time>2022-06-15 19:29:40</query_time>
<create_date>2019-09-24</create_date>
<update_date>2020-08-01</update_date>
<expiry_date>2025-09-24</expiry_date>
<domain_status>
<value>clientTransferProhibited</value>
<value>serverTransferProhibited</value>
</domain_status>
</value>
<value>
<num>27</num>
<domain_name>microdam.co.kr</domain_name>
<domain_keyword>microdam</domain_keyword>
<domain_tld>co.kr</domain_tld>
<query_time>2022-06-19 02:55:55</query_time>
<create_date>2004-09-24</create_date>
<update_date>2021-10-12</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>(?)???</registrar_name>
<registrar_website>http://www.gabia.co.kr</registrar_website>
<registrant_name>(?)?????</registrant_name>
<registrant_address>?? ??? ??? 1327-27?? ??????? 315? . Seocho-gu, Suite #315, Hanhwa Obelisk, 1327-27 Seocho-dong</registrant_address>
<registrant_zip>137070</registrant_zip>
</value>
<value>
<num>28</num>
<domain_name>kalitest.co.kr</domain_name>
<domain_keyword>kalitest</domain_keyword>
<domain_tld>co.kr</domain_tld>
<query_time>2022-06-21 06:27:31</query_time>
<create_date>2010-09-24</create_date>
<update_date>2011-05-20</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>(?)???</registrar_name>
<registrar_website>http://www.gabia.co.kr</registrar_website>
<registrant_name>???</registrant_name>
</value>
<value>
<num>29</num>
<domain_name>nasos.uz</domain_name>
<domain_keyword>nasos</domain_keyword>
<domain_tld>uz</domain_tld>
<query_time>2022-06-27 02:31:01</query_time>
<create_date>2009-09-23</create_date>
<update_date>2021-09-29</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>SARKOR TELECOM</registrar_name>
<name_servers>
<value>not.defined</value>
<value>ns1.jalolmurad.uz</value>
<value>ns2.jalolmurad.uz</value>
</name_servers>
<domain_status>
<value>ACTIVE</value>
</domain_status>
</value>
<value>
<num>30</num>
<domain_name>hbtec.kr</domain_name>
<domain_keyword>hbtec</domain_keyword>
<domain_tld>kr</domain_tld>
<query_time>2022-06-27 07:43:49</query_time>
<create_date>2017-09-24</create_date>
<update_date>2020-10-03</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>(?)???</registrar_name>
<registrar_website>http://www.gabia.co.kr</registrar_website>
<registrant_name>???</registrant_name>
</value>
<value>
<num>31</num>
<domain_name>fusion.mn</domain_name>
<domain_keyword>fusion</domain_keyword>
<domain_tld>mn</domain_tld>
<query_time>2022-06-27 10:06:37</query_time>
<create_date>2015-09-24</create_date>
<update_date>2021-05-07</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_iana>119</registrar_iana>
<registrar_name>Datacom Co., Ltd.</registrar_name>
<registrar_website>https://datacom.mn/</registrar_website>
<registrant_name>Fujii Kazunori</registrant_name>
<registrant_company>Fusion consulting LLC</registrant_company>
<registrant_address>SBD-7 11 horoolol 5a-32</registrant_address>
<registrant_city>ub</registrant_city>
<registrant_state>Ulaanbaatar</registrant_state>
<registrant_zip>976</registrant_zip>
<registrant_country>MN</registrant_country>
<registrant_email>[email protected]</registrant_email>
<registrant_phone>+976.95266919</registrant_phone>
<name_servers>
<value>ns1.dns.ne.jp</value>
<value>ns2.dns.ne.jp</value>
</name_servers>
<domain_status>
<value>ok</value>
</domain_status>
</value>
<value>
<num>32</num>
<domain_name>uspk.or.kr</domain_name>
<domain_keyword>uspk</domain_keyword>
<domain_tld>or.kr</domain_tld>
<query_time>2022-07-02 07:51:43</query_time>
<create_date>2004-09-24</create_date>
<update_date>2020-09-20</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>(?)?????</registrar_name>
<registrar_website>http://www.inames.co.kr</registrar_website>
<registrant_name>???</registrant_name>
</value>
<value>
<num>33</num>
<domain_name>miryangcc.co.kr</domain_name>
<domain_keyword>miryangcc</domain_keyword>
<domain_tld>co.kr</domain_tld>
<query_time>2022-07-03 21:41:11</query_time>
<create_date>2015-09-24</create_date>
<update_date>2020-08-17</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>(?)???</registrar_name>
<registrar_website>http://whois.co.kr</registrar_website>
<registrant_name>??? ??? ???</registrant_name>
<registrant_address>????? ??? ????34? 27 ??????? 3? 1101? #1101 Daerung post tower 182-4 guro3dong guro gu, Seoul</registrant_address>
<registrant_zip>08378</registrant_zip>
</value>
<value>
<num>34</num>
<domain_name>allogin.co.kr</domain_name>
<domain_keyword>allogin</domain_keyword>
<domain_tld>co.kr</domain_tld>
<query_time>2022-07-03 22:18:04</query_time>
<create_date>2014-09-24</create_date>
<update_date>2014-12-01</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>(?)???</registrar_name>
<registrar_website>http://whois.co.kr</registrar_website>
<registrant_name>???</registrant_name>
</value>
<value>
<num>35</num>
<domain_name>icaritas.or.kr</domain_name>
<domain_keyword>icaritas</domain_keyword>
<domain_tld>or.kr</domain_tld>
<query_time>2022-07-05 10:39:59</query_time>
<create_date>2001-09-24</create_date>
<update_date>2013-11-25</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>(?)?????</registrar_name>
<registrar_website>http://www.inames.co.kr</registrar_website>
<registrant_name>(?)??????????</registrant_name>
<registrant_address>?? ?? ??? 323 Imam-dong, Nam-gu, Gwangju, Republic of Korea, 323, Gwangju, KR</registrant_address>
<registrant_zip>503360</registrant_zip>
</value>
<value>
<num>36</num>
<domain_name>ochairs.co.kr</domain_name>
<domain_keyword>ochairs</domain_keyword>
<domain_tld>co.kr</domain_tld>
<query_time>2022-07-07 10:05:34</query_time>
<create_date>2010-09-24</create_date>
<update_date>2018-10-05</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>(?)???</registrar_name>
<registrar_website>http://www.gabia.co.kr</registrar_website>
<registrant_name>???? ????</registrant_name>
</value>
<value>
<num>37</num>
<domain_name>okkosher.co.kr</domain_name>
<domain_keyword>okkosher</domain_keyword>
<domain_tld>co.kr</domain_tld>
<query_time>2022-07-09 06:33:16</query_time>
<create_date>2010-09-24</create_date>
<update_date>2021-02-16</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>(?)???</registrar_name>
<registrar_website>http://www.gabia.co.kr</registrar_website>
<registrant_name>???</registrant_name>
<registrant_address>?? ??? ???? ??2? ????????? 102-1402 Ilsandong-gu, Goyang-si, Gyeonggi-do, Korea, 102-1402, Brown Stone Officetel, Baekseok 2-dong</registrant_address>
<registrant_zip>410907</registrant_zip>
</value>
<value>
<num>38</num>
<domain_name>academyinfo.kr</domain_name>
<domain_keyword>academyinfo</domain_keyword>
<domain_tld>kr</domain_tld>
<query_time>2022-07-12 10:23:55</query_time>
<create_date>2012-09-24</create_date>
<update_date>2022-06-22</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>(?)???</registrar_name>
<registrar_website>http://www.gabia.co.kr</registrar_website>
<registrant_name>?????????</registrant_name>
<registrant_address>????? ??? ???? 606 ?????? A? 23? 606, Seobusaet-gil, Geumcheon-gu, Seoul,</registrant_address>
<registrant_zip>08504</registrant_zip>
</value>
<value>
<num>39</num>
<domain_name>myco.gi</domain_name>
<domain_keyword>myco</domain_keyword>
<domain_tld>gi</domain_tld>
<query_time>2023-11-01 09:13:02</query_time>
<create_date>2021-09-24</create_date>
<update_date>2023-08-28</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_iana>800072</registrar_iana>
<registrar_name>GibNet Registrar</registrar_name>
<registrant_name>REDACTED FOR PRIVACY</registrant_name>
<registrant_company>MYCO LIMITED</registrant_company>
<registrant_address>REDACTED FOR PRIVACY</registrant_address>
<registrant_city>REDACTED FOR PRIVACY</registrant_city>
<registrant_state>Other</registrant_state>
<registrant_zip>REDACTED FOR PRIVACY</registrant_zip>
<registrant_country>GI</registrant_country>
<registrant_email>please query the rdds service of the registrar of record identified in this output for information on how to contact the registrant, admin, or tech contact of the queried domain name.</registrant_email>
<registrant_phone>REDACTED FOR PRIVACY</registrant_phone>
<registrant_fax>REDACTED FOR PRIVACY</registrant_fax>
<name_servers>
<value>ns0.mylondonserver.com</value>
<value>ns1.mylondonserver.com</value>
</name_servers>
<domain_status>
<value>clientTransferProhibited</value>
</domain_status>
<dns_sec>
<value>unsigned</value>
</dns_sec>
</value>
<value>
<num>40</num>
<domain_name>mistwear.pl</domain_name>
<domain_keyword>mistwear</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-01-27 20:57:02</query_time>
<create_date>2020-09-24</create_date>
<update_date>2022-09-01</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>home.pl S.A.</registrar_name>
<registrar_website>https://home.pl/kontakt</registrar_website>
<name_servers>
<value>dns.home.pl</value>
<value>dns2.home.pl</value>
<value>dns3.home.pl</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>41</num>
<domain_name>styl-projekt.pl</domain_name>
<domain_keyword>styl-projekt</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-02-19 12:23:48</query_time>
<create_date>2019-09-24</create_date>
<update_date>2023-10-19</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>PERSKIMEDIA Szymon Perski</registrar_name>
<name_servers>
<value>ns1.seohost.pl</value>
<value>ns2.seohost.pl</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>42</num>
<domain_name>klimatech-glogow.pl</domain_name>
<domain_keyword>klimatech-glogow</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-02-29 20:33:26</query_time>
<create_date>2019-09-24</create_date>
<update_date>2023-09-03</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>Globtel Internet Szymon Hersztek</registrar_name>
<name_servers>
<value>ns5.webd.pl</value>
<value>ns7.webd.pl</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>43</num>
<domain_name>stomatologia-jaworzynka.pl</domain_name>
<domain_keyword>stomatologia-jaworzynka</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-03 15:57:11</query_time>
<create_date>2018-09-24</create_date>
<update_date>2023-09-05</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>OVH SAS</registrar_name>
<registrar_website>https://www.ovhcloud.com</registrar_website>
<name_servers>
<value>ns.lh.pl</value>
<value>ns2.lh.pl</value>
<value>ns2.lighthosting.net</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>44</num>
<domain_name>el-par.pl</domain_name>
<domain_keyword>el-par</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-07 12:50:19</query_time>
<create_date>2015-09-24</create_date>
<update_date>2023-11-24</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>Consulting Service Sp. z o.o.</registrar_name>
<name_servers>
<value>ns1.i-host.pl</value>
<value>ns2.i-host.pl</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>45</num>
<domain_name>frankfurt.pl</domain_name>
<domain_keyword>frankfurt</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-07 23:02:16</query_time>
<create_date>2001-09-25</create_date>
<update_date>2020-09-23</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>home.pl S.A.</registrar_name>
<registrar_website>https://home.pl/kontakt</registrar_website>
<name_servers>
<value>ns1.racken.eu</value>
<value>ns2.racken.eu</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>46</num>
<domain_name>ekontenery.pl</domain_name>
<domain_keyword>ekontenery</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-08 00:40:10</query_time>
<create_date>2010-09-24</create_date>
<update_date>2020-05-21</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>home.pl S.A.</registrar_name>
<registrar_website>https://home.pl/kontakt</registrar_website>
<name_servers>
<value>dns.home.pl</value>
<value>dns2.home.pl</value>
<value>dns3.home.pl</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>47</num>
<domain_name>silniki-zem.pl</domain_name>
<domain_keyword>silniki-zem</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-08 08:58:36</query_time>
<create_date>2014-09-24</create_date>
<update_date>2023-09-19</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>home.pl S.A.</registrar_name>
<registrar_website>https://home.pl/kontakt</registrar_website>
<name_servers>
<value>dns.home.pl</value>
<value>dns2.home.pl</value>
<value>dns3.home.pl</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>48</num>
<domain_name>sppl.pl</domain_name>
<domain_keyword>sppl</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-09 08:22:58</query_time>
<create_date>2018-09-24</create_date>
<update_date>2023-09-25</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>OVH SAS</registrar_name>
<registrar_website>https://www.ovhcloud.com</registrar_website>
<name_servers>
<value>dns112.ovh.net</value>
<value>ns112.ovh.net</value>
</name_servers>
<dns_sec>
<value>Signed</value>
</dns_sec>
</value>
<value>
<num>49</num>
<domain_name>naszortodonta.pl</domain_name>
<domain_keyword>naszortodonta</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-09 10:02:02</query_time>
<create_date>2008-09-24</create_date>
<update_date>2022-08-08</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>home.pl S.A.</registrar_name>
<registrar_website>https://home.pl/kontakt</registrar_website>
<name_servers>
<value>ns1.smsy.co.pl</value>
<value>ns2.smsy.co.pl</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>50</num>
<domain_name>komat.net.pl</domain_name>
<domain_keyword>komat</domain_keyword>
<domain_tld>net.pl</domain_tld>
<query_time>2024-03-09 10:06:29</query_time>
<create_date>2021-09-24</create_date>
<update_date>2023-11-08</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>Consulting Service Sp. z o.o.</registrar_name>
<name_servers>
<value>ns1.i-host.pl</value>
<value>ns2.i-host.pl</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>51</num>
<domain_name>tartaksapula.pl</domain_name>
<domain_keyword>tartaksapula</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-10 10:33:13</query_time>
<create_date>2019-09-24</create_date>
<update_date>2022-05-30</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>Consulting Service Sp. z o.o.</registrar_name>
<name_servers>
<value>ns1.i-host.pl</value>
<value>ns2.i-host.pl</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>52</num>
<domain_name>altergeo.pl</domain_name>
<domain_keyword>altergeo</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-11 01:54:12</query_time>
<create_date>2020-09-24</create_date>
<update_date>2023-09-20</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>OVH SAS</registrar_name>
<registrar_website>https://www.ovhcloud.com</registrar_website>
<name_servers>
<value>dns112.ovh.net</value>
<value>ns112.ovh.net</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>53</num>
<domain_name>kancelariakredytywefrankach.pl</domain_name>
<domain_keyword>kancelariakredytywefrankach</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-11 15:30:14</query_time>
<create_date>2018-09-24</create_date>
<update_date>2022-06-30</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>Consulting Service Sp. z o.o.</registrar_name>
<name_servers>
<value>ns1.zenbox.pl</value>
<value>ns2.zenbox.pl</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>54</num>
<domain_name>wszystkodlabiura.pl</domain_name>
<domain_keyword>wszystkodlabiura</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-12 15:44:23</query_time>
<create_date>2018-09-24</create_date>
<update_date>2022-08-23</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>cyber_Folks S.A.</registrar_name>
<name_servers>
<value>ns1.ssd-dns.pl</value>
<value>ns2.ssd-dns.pl</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>55</num>
<domain_name>viverno.pl</domain_name>
<domain_keyword>viverno</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-12 21:31:27</query_time>
<create_date>2021-09-24</create_date>
<update_date>2023-08-25</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>home.pl S.A.</registrar_name>
<registrar_website>https://home.pl/kontakt</registrar_website>
<name_servers>
<value>dns.home.pl</value>
<value>dns2.home.pl</value>
<value>dns3.home.pl</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>56</num>
<domain_name>ryczace20.pl</domain_name>
<domain_keyword>ryczace20</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-13 05:51:49</query_time>
<create_date>2010-09-24</create_date>
<update_date>2023-08-29</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>Domena.pl sp. z o.o.</registrar_name>
<registrar_website>www.domena.pl</registrar_website>
<name_servers>
<value>ns1.looz.com.pl</value>
<value>ns2.looz.com.pl</value>
<value>ns3.looz.com.pl</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>57</num>
<domain_name>najprzystojniejszy.pl</domain_name>
<domain_keyword>najprzystojniejszy</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-13 19:05:32</query_time>
<create_date>2014-09-24</create_date>
<update_date>2022-04-25</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>OVH SAS</registrar_name>
<registrar_website>https://www.ovhcloud.com</registrar_website>
<name_servers>
<value>dns1.mydevil.net</value>
<value>dns2.mydevil.net</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>58</num>
<domain_name>energiadom.pl</domain_name>
<domain_keyword>energiadom</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-14 22:18:44</query_time>
<create_date>2018-09-24</create_date>
<update_date>2020-09-14</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>nazwa.pl sp. z o.o.</registrar_name>
<registrar_website>www.nazwa.pl</registrar_website>
<name_servers>
<value>ns1.nazwa.pl</value>
<value>ns2.nazwa.pl</value>
<value>ns3.nazwa.pl</value>
</name_servers>
<dns_sec>
<value>Signed</value>
</dns_sec>
</value>
<value>
<num>59</num>
<domain_name>fitamina.pl</domain_name>
<domain_keyword>fitamina</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-14 22:58:02</query_time>
<create_date>2014-09-24</create_date>
<update_date>2022-09-06</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>OVH SAS</registrar_name>
<registrar_website>https://www.ovhcloud.com</registrar_website>
<name_servers>
<value>ns1.zenbox.pl</value>
<value>ns2.zenbox.pl</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>60</num>
<domain_name>medi-car.pl</domain_name>
<domain_keyword>medi-car</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-15 00:16:02</query_time>
<create_date>2011-09-24</create_date>
<update_date>2024-01-01</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>OVH SAS</registrar_name>
<registrar_website>https://www.ovhcloud.com</registrar_website>
<name_servers>
<value>ns1.hekko.net.pl</value>
<value>ns2.hekko.net.pl</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>61</num>
<domain_name>biokompostownia.pl</domain_name>
<domain_keyword>biokompostownia</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-16 19:02:13</query_time>
<create_date>2018-09-24</create_date>
<update_date>2023-08-29</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>home.pl S.A.</registrar_name>
<registrar_website>https://home.pl/kontakt</registrar_website>
<name_servers>
<value>ns1.superhost.pl</value>
<value>ns2.superhost.pl</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>62</num>
<domain_name>pracowniczenoclegi.pl</domain_name>
<domain_keyword>pracowniczenoclegi</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-17 16:22:27</query_time>
<create_date>2018-09-24</create_date>
<update_date>2023-10-23</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>INFOCAL TECH sp. z o.o.</registrar_name>
<name_servers>
<value>ns1.iq.pl</value>
<value>ns2.iq.pl</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>63</num>
<domain_name>gwps.pl</domain_name>
<domain_keyword>gwps</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-17 18:14:02</query_time>
<create_date>2003-09-24</create_date>
<update_date>2023-09-18</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>Domena.pl sp. z o.o.</registrar_name>
<registrar_website>www.domena.pl</registrar_website>
<name_servers>
<value>dns11.linuxpl.com</value>
<value>ns11.linuxpl.com</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>64</num>
<domain_name>slodkachwila.pl</domain_name>
<domain_keyword>slodkachwila</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-19 02:04:26</query_time>
<create_date>2008-09-24</create_date>
<update_date>2024-01-23</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>Domena.pl sp. z o.o.</registrar_name>
<registrar_website>www.domena.pl</registrar_website>
<name_servers>
<value>ns1.domena.pl</value>
<value>ns2.domena.pl</value>
<value>ns3.domena.pl</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>65</num>
<domain_name>hotelregent.pl</domain_name>
<domain_keyword>hotelregent</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-20 06:08:42</query_time>
<create_date>2014-09-24</create_date>
<update_date>2018-09-28</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>OVH SAS</registrar_name>
<registrar_website>https://www.ovhcloud.com</registrar_website>
<name_servers>
<value>dns109.ovh.net</value>
<value>ns109.ovh.net</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>66</num>
<domain_name>kredyty-opole.pl</domain_name>
<domain_keyword>kredyty-opole</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-21 01:08:03</query_time>
<create_date>2014-09-24</create_date>
<update_date>2024-02-02</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>premium.pl Sp. z o.o.</registrar_name>
<registrar_website>https://premium.pl/kontakt</registrar_website>
<name_servers>
<value>ns1.kylos.pl</value>
<value>ns2.kylos.pl</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>67</num>
<domain_name>stylowniawnetrz.pl</domain_name>
<domain_keyword>stylowniawnetrz</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-21 08:08:28</query_time>
<create_date>2012-09-24</create_date>
<update_date>2023-09-18</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>Consulting Service Sp. z o.o.</registrar_name>
<name_servers>
<value>dns.home.pl</value>
<value>dns2.home.pl</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>68</num>
<domain_name>estromed.pl</domain_name>
<domain_keyword>estromed</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-22 02:05:10</query_time>
<create_date>2015-09-24</create_date>
<update_date>2022-09-01</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>Consulting Service Sp. z o.o.</registrar_name>
<name_servers>
<value>ns1.jchost11.pl</value>
<value>ns2.jchost11.pl</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>69</num>
<domain_name>oskextreme.pl</domain_name>
<domain_keyword>oskextreme</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-22 22:20:16</query_time>
<create_date>2013-09-24</create_date>
<update_date>2022-09-10</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>OVH SAS</registrar_name>
<registrar_website>https://www.ovhcloud.com</registrar_website>
<name_servers>
<value>ns1.zenbox.pl</value>
<value>ns2.zenbox.pl</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>70</num>
<domain_name>mediabrokergroup.pl</domain_name>
<domain_keyword>mediabrokergroup</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-23 13:00:29</query_time>
<create_date>2017-09-24</create_date>
<update_date>2023-09-11</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>home.pl S.A.</registrar_name>
<registrar_website>https://home.pl/kontakt</registrar_website>
<name_servers>
<value>dns.home.pl</value>
<value>dns2.home.pl</value>
<value>dns3.home.pl</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>71</num>
<domain_name>gminajaslo.pl</domain_name>
<domain_keyword>gminajaslo</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-23 17:19:56</query_time>
<create_date>2002-09-25</create_date>
<update_date>2024-01-25</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>Domena.pl sp. z o.o.</registrar_name>
<registrar_website>www.domena.pl</registrar_website>
<name_servers>
<value>ns1.domena.pl</value>
<value>ns2.domena.pl</value>
<value>ns3.domena.pl</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>72</num>
<domain_name>longniddryinn.co.uk</domain_name>
<domain_keyword>longniddryinn</domain_keyword>
<domain_tld>co.uk</domain_tld>
<query_time>2024-03-25 13:40:20</query_time>
<create_date>2009-09-24</create_date>
<update_date>2023-11-12</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>Freeola Limited t/a Freeola and Get Dotted [Tag = FREEOLA]</registrar_name>
<registrar_website>https://GetDotted.com</registrar_website>
<name_servers>
<value>ns3.freeola.net</value>
<value>ns4.freeola.net</value>
</name_servers>
<domain_status>
<value>Registered until expiry date.</value>
</domain_status>
</value>
<value>
<num>73</num>
<domain_name>leszcz.uk</domain_name>
<domain_keyword>leszcz</domain_keyword>
<domain_tld>uk</domain_tld>
<query_time>2024-03-25 14:23:21</query_time>
<create_date>2017-09-24</create_date>
<update_date>2022-06-27</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>OVH [Tag = OVH-FR]</registrar_name>
<registrar_website>http://www.ovh.com</registrar_website>
<name_servers>
<value>dns104.ovh.net</value>
<value>ns104.ovh.net</value>
</name_servers>
<domain_status>
<value>Registered until expiry date.</value>
</domain_status>
</value>
<value>
<num>74</num>
<domain_name>szpital-braniewo.pl</domain_name>
<domain_keyword>szpital-braniewo</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-25 17:42:48</query_time>
<create_date>2015-09-24</create_date>
<update_date>2023-10-21</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>Consulting Service Sp. z o.o.</registrar_name>
<name_servers>
<value>ns1.cyberfolks.pl</value>
<value>ns2.cyberfolks.pl</value>
<value>ns3.cyberfolks.pl</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>75</num>
<domain_name>annagilewska.pl</domain_name>
<domain_keyword>annagilewska</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-26 03:57:15</query_time>
<create_date>2004-09-24</create_date>
<update_date>2023-11-12</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>nazwa.pl sp. z o.o.</registrar_name>
<registrar_website>www.nazwa.pl</registrar_website>
<name_servers>
<value>ns1.dhosting.pl</value>
<value>ns2.dhosting.pl</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>76</num>
<domain_name>palacradomilow.pl</domain_name>
<domain_keyword>palacradomilow</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-27 07:24:42</query_time>
<create_date>2013-09-24</create_date>
<update_date>2023-02-12</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>home.pl S.A.</registrar_name>
<registrar_website>https://home.pl/kontakt</registrar_website>
<name_servers>
<value>ns1.cyberfolks.pl</value>
<value>ns2.cyberfolks.pl</value>
<value>ns3.cyberfolks.pl</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>77</num>
<domain_name>wns.pl</domain_name>
<domain_keyword>wns</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-27 08:58:26</query_time>
<create_date>2003-09-24</create_date>
<update_date>2023-03-01</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>nazwa.pl sp. z o.o.</registrar_name>
<registrar_website>www.nazwa.pl</registrar_website>
<name_servers>
<value>ns1.nazwa.pl</value>
<value>ns2.nazwa.pl</value>
<value>ns3.nazwa.pl</value>
</name_servers>
<dns_sec>
<value>Signed</value>
</dns_sec>
</value>
<value>
<num>78</num>
<domain_name>thegardenapartment.co.uk</domain_name>
<domain_keyword>thegardenapartment</domain_keyword>
<domain_tld>co.uk</domain_tld>
<query_time>2024-03-29 03:31:53</query_time>
<create_date>2019-09-24</create_date>
<update_date>2023-09-25</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>GoDaddy.com, LLC. [Tag = GODADDY]</registrar_name>
<registrar_website>http://uk.godaddy.com</registrar_website>
<name_servers>
<value>ns19.domaincontrol.com</value>
<value>ns20.domaincontrol.com</value>
</name_servers>
<domain_status>
<value>Registered until expiry date.</value>
</domain_status>
</value>
<value>
<num>79</num>
<domain_name>survey.pl</domain_name>
<domain_keyword>survey</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-29 08:46:04</query_time>
<create_date>2014-09-24</create_date>
<update_date>2023-11-16</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>Aftermarket.pl Limited</registrar_name>
<registrar_website>http://www.AfterMarket.pl/contact.php</registrar_website>
<name_servers>
<value>ns1.aftermarket.pl</value>
<value>ns2.aftermarket.pl</value>
</name_servers>
<dns_sec>
<value>Signed</value>
</dns_sec>
</value>
<value>
<num>80</num>
<domain_name>polna.com.pl</domain_name>
<domain_keyword>polna</domain_keyword>
<domain_tld>com.pl</domain_tld>
<query_time>2024-03-29 12:52:09</query_time>
<create_date>2000-09-25</create_date>
<update_date>2023-09-05</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>Domena.pl sp. z o.o.</registrar_name>
<registrar_website>www.domena.pl</registrar_website>
<name_servers>
<value>dns1.spider.pl</value>
<value>dns2.spider.pl</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>81</num>
<domain_name>doublegoldcoaching.co.uk</domain_name>
<domain_keyword>doublegoldcoaching</domain_keyword>
<domain_tld>co.uk</domain_tld>
<query_time>2024-03-29 13:20:13</query_time>
<create_date>2021-09-24</create_date>
<update_date>2023-08-29</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>Ikiji Ltd t/a Ikiji [Tag = IKIJI]</registrar_name>
<registrar_website>https://portal.ikiji.com</registrar_website>
<name_servers>
<value>ns1.ikiji.com</value>
<value>ns2.ikiji.com</value>
<value>ns3.ikiji.com</value>
</name_servers>
<domain_status>
<value>Registered until expiry date.</value>
</domain_status>
</value>
<value>
<num>82</num>
<domain_name>stingteam.co.uk</domain_name>
<domain_keyword>stingteam</domain_keyword>
<domain_tld>co.uk</domain_tld>
<query_time>2024-03-30 04:00:55</query_time>
<create_date>2023-09-24</create_date>
<update_date>2023-12-10</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>123-Reg Limited t/a 123-reg [Tag = 123-REG]</registrar_name>
<registrar_website>https://www.123-reg.co.uk</registrar_website>
<name_servers>
<value>ns45.domaincontrol.com</value>
<value>ns46.domaincontrol.com</value>
</name_servers>
<domain_status>
<value>Registered until expiry date.</value>
</domain_status>
</value>
<value>
<num>83</num>
<domain_name>brandicarrfarm.co.uk</domain_name>
<domain_keyword>brandicarrfarm</domain_keyword>
<domain_tld>co.uk</domain_tld>
<query_time>2024-03-30 05:51:15</query_time>
<create_date>2019-09-24</create_date>
<update_date>2023-08-25</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>Fasthosts Internet Ltd [Tag = LIVEDOMAINS]</registrar_name>
<registrar_website>http://www.fasthosts.co.uk</registrar_website>
<name_servers>
<value>ns1.livedns.co.uk</value>
<value>ns2.livedns.co.uk</value>
<value>ns3.livedns.co.uk</value>
</name_servers>
<domain_status>
<value>Registered until expiry date.</value>
</domain_status>
</value>
<value>
<num>84</num>
<domain_name>o1om.co.uk</domain_name>
<domain_keyword>o1om</domain_keyword>
<domain_tld>co.uk</domain_tld>
<query_time>2024-03-30 13:03:01</query_time>
<create_date>2023-09-24</create_date>
<update_date>2023-09-24</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>Fasthosts Internet Ltd [Tag = LIVEDOMAINS]</registrar_name>
<registrar_website>http://www.fasthosts.co.uk</registrar_website>
<name_servers>
<value>ns1.livedns.co.uk</value>
<value>ns2.livedns.co.uk</value>
<value>ns3.livedns.co.uk</value>
</name_servers>
<domain_status>
<value>Registered until expiry date.</value>
</domain_status>
</value>
<value>
<num>85</num>
<domain_name>cookiegirl.co.uk</domain_name>
<domain_keyword>cookiegirl</domain_keyword>
<domain_tld>co.uk</domain_tld>
<query_time>2024-03-30 13:44:19</query_time>
<create_date>2004-09-24</create_date>
<update_date>2023-06-22</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>Ionos SE [Tag = 1AND1]</registrar_name>
<registrar_website>https://ionos.com</registrar_website>
<name_servers>
<value>ns1070.ui-dns.biz</value>
<value>ns1070.ui-dns.com</value>
<value>ns1070.ui-dns.de</value>
<value>ns1070.ui-dns.org</value>
</name_servers>
<domain_status>
<value>Registered until expiry date.</value>
</domain_status>
</value>
<value>
<num>86</num>
<domain_name>hazlieburn.co.uk</domain_name>
<domain_keyword>hazlieburn</domain_keyword>
<domain_tld>co.uk</domain_tld>
<query_time>2024-03-30 16:56:06</query_time>
<create_date>2021-09-24</create_date>
<update_date>2023-08-29</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>Fasthosts Internet Ltd [Tag = LIVEDOMAINS]</registrar_name>
<registrar_website>http://www.fasthosts.co.uk</registrar_website>
<name_servers>
<value>ns1.livedns.co.uk</value>
<value>ns2.livedns.co.uk</value>
<value>ns3.livedns.co.uk</value>
</name_servers>
<domain_status>
<value>Registered until expiry date.</value>
</domain_status>
</value>
<value>
<num>87</num>
<domain_name>bartlomiejsienkiewicz.pl</domain_name>
<domain_keyword>bartlomiejsienkiewicz</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-31 02:14:16</query_time>
<create_date>2018-09-24</create_date>
<update_date>2023-09-25</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>OVH SAS</registrar_name>
<registrar_website>https://www.ovhcloud.com</registrar_website>
<name_servers>
<value>dns112.ovh.net</value>
<value>ns112.ovh.net</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>88</num>
<domain_name>londonfunctionalmedics.co.uk</domain_name>
<domain_keyword>londonfunctionalmedics</domain_keyword>
<domain_tld>co.uk</domain_tld>
<query_time>2024-04-01 02:52:04</query_time>
<create_date>2023-09-24</create_date>
<update_date>2023-12-20</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>123-Reg Limited t/a 123-reg [Tag = 123-REG]</registrar_name>
<registrar_website>https://www.123-reg.co.uk</registrar_website>
<name_servers>
<value>ns13.domaincontrol.com</value>
<value>ns14.domaincontrol.com</value>
</name_servers>
<domain_status>
<value>Registered until expiry date.</value>
</domain_status>
</value>
<value>
<num>89</num>
<domain_name>londoninternationalrallye.uk</domain_name>
<domain_keyword>londoninternationalrallye</domain_keyword>
<domain_tld>uk</domain_tld>
<query_time>2024-04-01 02:53:24</query_time>
<create_date>2023-09-24</create_date>
<update_date>2023-09-24</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>GoDaddy.com, LLC. [Tag = GODADDY]</registrar_name>
<registrar_website>http://uk.godaddy.com</registrar_website>
<name_servers>
<value>ns45.domaincontrol.com</value>
<value>ns46.domaincontrol.com</value>
</name_servers>
<domain_status>
<value>Registered until expiry date.</value>
</domain_status>
</value>
<value>
<num>90</num>
<domain_name>evolvefamily.co.uk</domain_name>
<domain_keyword>evolvefamily</domain_keyword>
<domain_tld>co.uk</domain_tld>
<query_time>2024-04-01 03:11:46</query_time>
<create_date>2015-09-24</create_date>
<update_date>2023-08-25</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>Fasthosts Internet Ltd [Tag = LIVEDOMAINS]</registrar_name>
<registrar_website>http://www.fasthosts.co.uk</registrar_website>
<name_servers>
<value>ns1.livedns.co.uk</value>
<value>ns2.livedns.co.uk</value>
<value>ns3.livedns.co.uk</value>
</name_servers>
<domain_status>
<value>Registered until expiry date.</value>
</domain_status>
</value>
<value>
<num>91</num>
<domain_name>mellors.me.uk</domain_name>
<domain_keyword>mellors</domain_keyword>
<domain_tld>me.uk</domain_tld>
<query_time>2024-04-01 09:31:26</query_time>
<create_date>2009-09-24</create_date>
<update_date>2023-09-23</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>Ionos SE [Tag = 1AND1]</registrar_name>
<registrar_website>https://ionos.com</registrar_website>
<name_servers>
<value>ns1055.ui-dns.biz</value>
<value>ns1055.ui-dns.com</value>
<value>ns1055.ui-dns.de</value>
<value>ns1055.ui-dns.org</value>
</name_servers>
<domain_status>
<value>Registered until expiry date.</value>
</domain_status>
</value>
<value>
<num>92</num>
<domain_name>stjamesconservation.co.uk</domain_name>
<domain_keyword>stjamesconservation</domain_keyword>
<domain_tld>co.uk</domain_tld>
<query_time>2024-04-01 10:42:46</query_time>
<create_date>2015-09-24</create_date>
<update_date>2023-12-05</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>123-Reg Limited t/a 123-reg [Tag = 123-REG]</registrar_name>
<registrar_website>https://www.123-reg.co.uk</registrar_website>
<name_servers>
<value>ns55.domaincontrol.com</value>
<value>ns56.domaincontrol.com</value>
</name_servers>
<domain_status>
<value>Registered until expiry date.</value>
</domain_status>
</value>
<value>
<num>93</num>
<domain_name>crescent-grove.co.uk</domain_name>
<domain_keyword>crescent-grove</domain_keyword>
<domain_tld>co.uk</domain_tld>
<query_time>2024-04-01 11:32:15</query_time>
<create_date>2019-09-24</create_date>
<update_date>2023-09-25</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>GoDaddy.com, LLC. [Tag = GODADDY]</registrar_name>
<registrar_website>http://uk.godaddy.com</registrar_website>
<name_servers>
<value>ns19.domaincontrol.com</value>
<value>ns20.domaincontrol.com</value>
</name_servers>
<domain_status>
<value>Registered until expiry date.</value>
</domain_status>
</value>
<value>
<num>94</num>
<domain_name>hiszpanskiodreki.pl</domain_name>
<domain_keyword>hiszpanskiodreki</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-04-01 14:00:50</query_time>
<create_date>2017-09-24</create_date>
<update_date>2024-03-08</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>home.pl S.A.</registrar_name>
<registrar_website>https://home.pl/kontakt</registrar_website>
<name_servers>
<value>dns.home.pl</value>
<value>dns2.home.pl</value>
<value>dns3.home.pl</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>95</num>
<domain_name>dalintobertrading.co.uk</domain_name>
<domain_keyword>dalintobertrading</domain_keyword>
<domain_tld>co.uk</domain_tld>
<query_time>2024-04-01 17:02:05</query_time>
<create_date>2021-09-24</create_date>
<update_date>2023-09-25</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>GoDaddy.com, LLC. [Tag = GODADDY]</registrar_name>
<registrar_website>http://uk.godaddy.com</registrar_website>
<name_servers>
<value>ns49.domaincontrol.com</value>
<value>ns50.domaincontrol.com</value>
</name_servers>
<domain_status>
<value>Registered until expiry date.</value>
</domain_status>
</value>
<value>
<num>96</num>
<domain_name>brilliantroom.co.uk</domain_name>
<domain_keyword>brilliantroom</domain_keyword>
<domain_tld>co.uk</domain_tld>
<query_time>2024-04-01 17:23:30</query_time>
<create_date>2003-09-24</create_date>
<update_date>2023-09-24</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>LCN.com Ltd [Tag = LCN]</registrar_name>
<registrar_website>http://www.lcn.com</registrar_website>
<name_servers>
<value>ns0.lcn.com</value>
<value>ns1.lcn.com</value>
<value>ns2.lcn.com</value>
</name_servers>
<domain_status>
<value>Registered until expiry date.</value>
</domain_status>
</value>
<value>
<num>97</num>
<domain_name>fizjolangchlasta.pl</domain_name>
<domain_keyword>fizjolangchlasta</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-04-01 19:01:58</query_time>
<create_date>2021-09-24</create_date>
<update_date>2023-09-05</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>Hosting Concepts B.V.</registrar_name>
<name_servers>
<value>ns1.dns-parking.com</value>
<value>ns2.dns-parking.com</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>98</num>
<domain_name>yarnandsinker.co.uk</domain_name>
<domain_keyword>yarnandsinker</domain_keyword>
<domain_tld>co.uk</domain_tld>
<query_time>2024-04-01 23:36:58</query_time>
<create_date>2023-09-24</create_date>
<update_date>2023-09-24</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>20i Ltd [Tag = STACK]</registrar_name>
<registrar_website>http://www.20i.com</registrar_website>
<name_servers>
<value>ns1.stackdns.com</value>
<value>ns2.stackdns.com</value>
<value>ns3.stackdns.com</value>
<value>ns4.stackdns.com</value>
</name_servers>
<domain_status>
<value>Registered until expiry date.</value>
</domain_status>
</value>
<value>
<num>99</num>
<domain_name>bijawellness.co.uk</domain_name>
<domain_keyword>bijawellness</domain_keyword>
<domain_tld>co.uk</domain_tld>
<query_time>2024-04-02 00:08:19</query_time>
<create_date>2023-09-24</create_date>
<update_date>2023-12-10</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>123-Reg Limited t/a 123-reg [Tag = 123-REG]</registrar_name>
<registrar_website>https://www.123-reg.co.uk</registrar_website>
<name_servers>
<value>ns23.domaincontrol.com</value>
<value>ns24.domaincontrol.com</value>
</name_servers>
<domain_status>
<value>Registered until expiry date.</value>
</domain_status>
</value>
<value>
<num>100</num>
<domain_name>bijawellbeing.co.uk</domain_name>
<domain_keyword>bijawellbeing</domain_keyword>
<domain_tld>co.uk</domain_tld>
<query_time>2024-04-02 00:08:19</query_time>
<create_date>2023-09-24</create_date>
<update_date>2023-12-10</update_date>
<expiry_date>2025-09-24</expiry_date>
<registrar_name>123-Reg Limited t/a 123-reg [Tag = 123-REG]</registrar_name>
<registrar_website>https://www.123-reg.co.uk</registrar_website>
<name_servers>
<value>ns51.domaincontrol.com</value>
<value>ns52.domaincontrol.com</value>
</name_servers>
<domain_status>
<value>Registered until expiry date.</value>
</domain_status>
</value>
</results>
<search_after>1712016499000_15627</search_after>
<stats>
<total_time>0.59</total_time>
<api_credits_used>1</api_credits_used>
<cost_calculation>1 (search_fields[expiry_date])</cost_calculation>
</stats>
</root>API Pricing and Packages
Can be used for Current WHOIS API, Bulk WHOIS API, WHOIS History API, Reverse WHOIS API and Fuzzy Domains API.
| Package | Quantity | Price | Rate ⇩ | Order |
|---|---|---|---|---|
| 5,000 API Credits | 5,000 | $25 | $5.00 | Buy Now |
| 25,000 API Credits | 25,000 | $100 | $4.00 | Buy Now |
| 250,000 API Credits | 250,000 | $750 | $3.00 | Buy Now |
| 1 Million API Credits Most Popular | 1,000,000 | $2,000 | $2.00 | Buy Now |
| 10 Million API Credits | 10,000,000 | $10,000 | $1.00 | Buy Now |
API Credits you purchase have lifetime validity, and you may use it whenever you wish. We accept Visa, Mastercard, American Express, Discover, Diners Club, JCB and China UnionPay. Popular payment wallets like Apple Pay, Google Pay, Alipay, WeChat Pay & Cash App Pay are accepted. You can also pay in installments through Buy Now, Pay Later (Affirm, Afterpay, Clearpay, Klarna) services. For orders worth $1000 and higher, you can also pay through Bank Wire Transfer (ACH, Fedwire and SWIFT). We also accept crypto payments through Bitcoin, Ethereum, Tether, Binance, Ripple and 100+ Cryptocurrencies.
Reverse WHOIS Lookup
You may test our powerful Reverse WHOIS API using the below form.