We found more than 10,000 results (in 0.564 seconds) for your search in our Current WHOIS Database.
Domain Name | Registered | Expiry | Registrar | Ownership | |
---|---|---|---|---|---|
1 | ce.or.kr | 8 Apr 2020 | 8 Apr 2025 | (?)??? | ????? ????? |
2 | onmoving.co.kr | 8 Apr 2020 | 8 Apr 2024 | (?)??? | ????? |
3 | indiehouse.co.kr | 8 Apr 2020 | 8 Apr 2025 | (?)??? | ??????? ????? |
4 | mainstreet.co.kr | 8 Apr 2020 | 8 Apr 2030 | (?)??? | ??? ??? |
5 | tiny.my.id | 8 Apr 2020 | 8 Apr 2024 | - | - |
6 | kwskg.or.kr | 8 Apr 2020 | 8 Apr 2025 | (?)??? | ?????? |
7 | nuteco.uz | 8 Apr 2020 | 8 Apr 2024 | BILLURCOM | - |
8 | recettesdecuisine.ma | 8 Apr 2020 | 8 Apr 2024 | MEGALOGI | Fatima Zahra LAMOUALDI |
9 | ptgbk.co.id | 8 Apr 2020 | 8 Apr 2024 | - | - |
10 | componentsonly.mn | 8 Apr 2020 | 8 Apr 2024 | Datacom Co., Ltd. | United Media Works |
11 | samehada.my.id | 8 Apr 2020 | 8 Apr 2025 | - | - |
12 | chatoire.re | 8 Apr 2020 | 8 Apr 2024 | GANDI | CENTRE COMMERCIAL DU TAMPON 2 |
13 | galmaemot.or.kr | 8 Apr 2020 | 8 Apr 2025 | (?)??? | ??????? |
14 | vitamilk.uz | 8 Apr 2020 | 8 Apr 2026 | BILLURCOM | - |
15 | syfens.ma | 8 Apr 2020 | 8 Apr 2024 | CREATIVE INTERNET SOLUTIONS | Salima Khattabi |
16 | avsystem.ma | 8 Apr 2020 | 8 Apr 2024 | CREATIVE INTERNET SOLUTIONS | AVSYSTEM |
17 | viz.sc | 8 Apr 2020 | 8 Apr 2024 | VCS Pty Ltd | REDACTED FOR PRIVACY |
18 | pts.ms | 8 Apr 2020 | 8 Apr 2026 | Key-Systems | PTS Consulting |
19 | zamowmaterac.pl | 8 Apr 2020 | 8 Apr 2024 | dhosting.pl Sp. z o.o. | - |
20 | wybrednamaruda.pl | 8 Apr 2020 | 8 Apr 2024 | OVH SAS | - |
21 | sts-tv.pl | 8 Apr 2020 | 8 Apr 2024 | Aftermarket.pl Limited | - |
22 | koloseo.pl | 8 Apr 2020 | 8 Apr 2024 | dhosting.pl Sp. z o.o. | - |
23 | jaroszmiroslaw.pl | 8 Apr 2020 | 8 Apr 2024 | OVH SAS | - |
24 | urzeczegassy.pl | 8 Apr 2020 | 8 Apr 2024 | cyber_Folks S.A. | - |
25 | fundacjapoz.pl | 8 Apr 2020 | 8 Apr 2024 | nazwa.pl sp. z o.o. | - |
26 | tomekflorja.pl | 8 Apr 2020 | 8 Apr 2024 | LH.pl Sp. z o.o. | - |
27 | przewozyberlinski.pl | 8 Apr 2020 | 8 Apr 2026 | Consulting Service Sp. z o.o. | - |
28 | sklepklasa.pl | 8 Apr 2020 | 8 Apr 2024 | OVH SAS | - |
29 | polishpremium.pl | 8 Apr 2020 | 8 Apr 2025 | OVH SAS | - |
30 | apartamentyrajcza.pl | 8 Apr 2020 | 8 Apr 2024 | Smarthost Sp. z o.o. | - |
31 | xn--podruje-o0a74j.pl | 8 Apr 2020 | 8 Apr 2024 | Aftermarket.pl Limited | - |
32 | kasztanowapark.pl | 8 Apr 2020 | 8 Apr 2025 | OVH SAS | - |
33 | agnieszkagebusia.pl | 8 Apr 2020 | 8 Apr 2024 | LH.pl Sp. z o.o. | - |
34 | wiktorkowalski.pl | 8 Apr 2020 | 8 Apr 2025 | OVH SAS | - |
35 | notariuszegdynia.pl | 8 Apr 2020 | 8 Apr 2024 | home.pl S.A. | - |
36 | brylcar.pl | 8 Apr 2020 | 8 Apr 2026 | Consulting Service Sp. z o.o. | - |
37 | mwinstal.pl | 8 Apr 2020 | 8 Apr 2029 | OVH SAS | - |
38 | ekojudecki.pl | 8 Apr 2020 | 8 Apr 2024 | OVH SAS | - |
39 | nwstal.pl | 8 Apr 2020 | 8 Apr 2025 | home.pl S.A. | - |
40 | meblearino.pl | 8 Apr 2020 | 8 Apr 2024 | AZ.pl Sp. z o.o. | - |
41 | skleppm.pl | 8 Apr 2020 | 8 Apr 2024 | cyber_Folks S.A. | - |
42 | symbicortturbuhaler.co.uk | 8 Apr 2020 | 8 Apr 2025 | Nom-IQ Limited t/a Com Laude [Tag = NOMIQ] | - |
43 | zappatos.uk | 8 Apr 2020 | 8 Apr 2025 | MARCARIA.COM International Inc [Tag = MARCARIA-US] | - |
44 | car-man.pl | 8 Apr 2020 | 8 Apr 2025 | Consulting Service Sp. z o.o. | - |
45 | polisa-grupowa.pl | 8 Apr 2020 | 8 Apr 2024 | nazwa.pl sp. z o.o. | - |
46 | ptsm.com.pl | 8 Apr 2020 | 8 Apr 2024 | nazwa.pl sp. z o.o. | - |
47 | caigatetex.co.uk | 8 Apr 2020 | 8 Apr 2025 | 123-Reg Limited t/a 123-reg [Tag = 123-REG] | - |
48 | poradnikzwiazkowca.pl | 8 Apr 2020 | 8 Apr 2024 | LH.pl Sp. z o.o. | - |
49 | mojelektryk.pl | 8 Apr 2020 | 8 Apr 2024 | cyber_Folks S.A. | - |
50 | colorfolk.pl | 8 Apr 2020 | 8 Apr 2024 | home.pl S.A. | - |
51 | pracownicyzfilipin.pl | 8 Apr 2020 | 8 Apr 2024 | PERSKIMEDIA Szymon Perski | - |
52 | wygodnakanapa.pl | 8 Apr 2020 | 8 Apr 2024 | OVH SAS | - |
53 | wartkaakcja.pl | 8 Apr 2020 | 8 Apr 2024 | LH.pl Sp. z o.o. | - |
54 | polcrane.pl | 8 Apr 2020 | 8 Apr 2024 | Consulting Service Sp. z o.o. | - |
55 | pomponkomis.pl | 8 Apr 2020 | 8 Apr 2024 | AZ.pl Sp. z o.o. | - |
56 | galeriakochanestarocie.pl | 8 Apr 2020 | 8 Apr 2024 | home.pl S.A. | - |
57 | printtime.co.uk | 8 Apr 2020 | 8 Apr 2024 | Garth Piesse [Tag = COHERENT-NZ] | - |
58 | dekarz-katowice.pl | 8 Apr 2020 | 8 Apr 2026 | Consulting Service Sp. z o.o. | - |
59 | anticoasianexell.com | 8 Apr 2020 | 8 Apr 2026 | Whois Corp. | CoAsia Corporation |
60 | whozzbuy.com | 8 Apr 2020 | 8 Apr 2025 | NameSilo, LLC | See PrivacyGuardian.org |
61 | ctfireblade.com | 8 Apr 2020 | 8 Apr 2025 | PDR Ltd. d/b/a PublicDomainRegistry.com | Privacy Protect, LLC (PrivacyProtect.org) |
62 | komurodesignhouse.com | 8 Apr 2020 | 8 Apr 2025 | DREAMHOST | Proxy Protection LLC |
63 | apmfs.com | 8 Apr 2020 | 8 Apr 2025 | TurnCommerce, Inc. DBA NameBright.com | HugeDomains.com |
64 | tatsu.ninja | 8 Apr 2020 | 8 Apr 2025 | GoDaddy.com, LLC | Domains By Proxy, LLC |
65 | i-pinky-swear.com | 8 Apr 2020 | 8 Apr 2025 | Hosting Concepts B.V. d/b/a Registrar.eu | Parsley Studio's CC |
66 | taxhawk.live | 8 Apr 2020 | 8 Apr 2025 | Network Solutions, LLC | TaxHawk, Inc |
67 | newchungfishchipsandchinesetakeaway.com | 8 Apr 2020 | 8 Apr 2025 | Cloudflare, Inc. | DATA REDACTED |
68 | ispotdesignexpression.com | 8 Apr 2020 | 8 Apr 2025 | ENOM, INC. | REDACTED FOR PRIVACY |
69 | newfundingupdate.com | 8 Apr 2020 | 8 Apr 2025 | Amazon Registrar, Inc. | Identity Protection Service |
70 | sktmanba.com | 8 Apr 2020 | 8 Apr 2028 | CSL Computer Service Langenbach GmbH d/b/a joker.com | - |
71 | dentalfocus.org | 8 Apr 2020 | 8 Apr 2025 | Tucows Domains Inc. | Sucofocus Ltd |
72 | astohapico.co.jp | 8 Apr 2020 | - | - | TOPBROSSAN CO.,LTD |
73 | skyfuture.xyz | 8 Apr 2020 | 8 Apr 2025 | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.net.cn) | Shenzhen Skyfuture Film Profuction Co.,Ltd |
74 | thinkaheadfinancial.com | 8 Apr 2020 | 8 Apr 2029 | Register.ca Inc | SafeWhois.ca Whois Privacy Service |
75 | esperanzatoros.org | 8 Apr 2020 | 8 Apr 2025 | Amazon Registrar, Inc. | Identity Protection Service |
76 | innovationhomegroup.com | 8 Apr 2020 | 8 Apr 2025 | 1API GmbH | REDACTED FOR PRIVACY |
77 | innovationhomeshop.com | 8 Apr 2020 | 8 Apr 2025 | 1API GmbH | - |
78 | innovationhome.info | 8 Apr 2020 | 8 Apr 2025 | 1API GmbH | Registrant of innovationhome.info |
79 | innovationhomeworld.com | 8 Apr 2020 | 8 Apr 2025 | 1API GmbH | - |
80 | goesbattery.com | 8 Apr 2020 | 8 Apr 2025 | Alibaba Cloud Computing (Beijing) Co., Ltd. | - |
81 | avalon-lab.coop | 8 Apr 2020 | 8 Apr 2025 | Gandi SAS | Avalon Lab |
82 | active-coin.xyz | 8 Apr 2020 | 8 Apr 2025 | URL Solutions Inc. | GLOBAL DOMAIN PRIVACY SERVICES INC |
83 | active-senior-net.com | 8 Apr 2020 | 8 Apr 2025 | Netowl, Inc. | Xserver Inc. |
84 | ecic.online | 8 Apr 2020 | 8 Apr 2025 | Gandi SAS | - |
85 | eco-rns.com | 8 Apr 2020 | 8 Apr 2025 | gabia | Ryu Kyu Bo |
86 | micmacsttropez.net | 8 Apr 2020 | 8 Apr 2025 | Gandi SAS | - |
87 | beltimpex.com | 8 Apr 2020 | 7 Apr 2025 | Regional Network Information Center, JSC dba RU-CENTER | TPK Beltimpex Ltd |
88 | clairdelunerosporden.com | 8 Apr 2020 | 8 Apr 2026 | Wix.com Ltd. | - |
89 | authormx.com | 8 Apr 2020 | 8 Apr 2025 | ENOM, INC. | REDACTED FOR PRIVACY |
90 | distanciationsociale.ca | 8 Apr 2020 | 8 Apr 2025 | WHC Online Solutions Inc. | Junior Tifo Consultant |
91 | viperbestass.com | 8 Apr 2020 | 8 Apr 2025 | Cloudflare, Inc. | DATA REDACTED |
92 | sidehustlesavior.com | 8 Apr 2020 | 8 Apr 2025 | NAMECHEAP INC | Privacy service provided by Withheld for Privacy ehf |
93 | disus.net | 8 Apr 2020 | 8 Apr 2026 | Namespro Solutions INC. | Namespro.ca PrivateWHOIS |
94 | haciendalasadelitas.com | 8 Apr 2020 | 8 Apr 2025 | GoDaddy.com, LLC | Domains By Proxy, LLC |
95 | findmythoughts.com | 8 Apr 2020 | 8 Apr 2025 | Automattic Inc. | Knock Knock WHOIS Not There, LLC |
96 | findnowi.com | 8 Apr 2020 | 8 Apr 2025 | NAMECHEAP INC | Privacy service provided by Withheld for Privacy ehf |
97 | findwalks.com | 8 Apr 2020 | 8 Apr 2025 | TurnCommerce, Inc. DBA NameBright.com | HugeDomains.com |
98 | findyourhappinesstest.com | 8 Apr 2020 | 8 Apr 2025 | Amazon Registrar, Inc. | Identity Protection Service |
99 | the-sample-design.com | 8 Apr 2020 | 8 Apr 2025 | GMO INTERNET, INC. | Whois Privacy Protection Service by MuuMuuDomain |
100 | the51x.com | 8 Apr 2020 | 8 Apr 2025 | Whois Corp. | cho sangeun |
You can fetch the above results in JSON or XML format through our API:
{
"success": true,
"query": {
"database": "current",
"create_date": "2020-04-08",
"sort_by": "query_time",
"sort_order": "asc",
"page_size": 100
},
"count": {
"total": 10000,
"relation": "gte",
"current": 100
},
"unique_domains": "ce.or.kr, onmoving.co.kr, indiehouse.co.kr, mainstreet.co.kr, tiny.my.id, kwskg.or.kr, nuteco.uz, recettesdecuisine.ma, ptgbk.co.id, componentsonly.mn, samehada.my.id, chatoire.re, galmaemot.or.kr, vitamilk.uz, syfens.ma, avsystem.ma, viz.sc, pts.ms, zamowmaterac.pl, wybrednamaruda.pl, sts-tv.pl, koloseo.pl, jaroszmiroslaw.pl, urzeczegassy.pl, fundacjapoz.pl, tomekflorja.pl, przewozyberlinski.pl, sklepklasa.pl, polishpremium.pl, apartamentyrajcza.pl, xn--podruje-o0a74j.pl, kasztanowapark.pl, agnieszkagebusia.pl, wiktorkowalski.pl, notariuszegdynia.pl, brylcar.pl, mwinstal.pl, ekojudecki.pl, nwstal.pl, meblearino.pl, skleppm.pl, symbicortturbuhaler.co.uk, zappatos.uk, car-man.pl, polisa-grupowa.pl, ptsm.com.pl, caigatetex.co.uk, poradnikzwiazkowca.pl, mojelektryk.pl, colorfolk.pl, pracownicyzfilipin.pl, wygodnakanapa.pl, wartkaakcja.pl, polcrane.pl, pomponkomis.pl, galeriakochanestarocie.pl, printtime.co.uk, dekarz-katowice.pl, anticoasianexell.com, whozzbuy.com, ctfireblade.com, komurodesignhouse.com, apmfs.com, tatsu.ninja, i-pinky-swear.com, taxhawk.live, newchungfishchipsandchinesetakeaway.com, ispotdesignexpression.com, newfundingupdate.com, sktmanba.com, dentalfocus.org, astohapico.co.jp, skyfuture.xyz, thinkaheadfinancial.com, esperanzatoros.org, innovationhomegroup.com, innovationhomeshop.com, innovationhome.info, innovationhomeworld.com, goesbattery.com, avalon-lab.coop, active-coin.xyz, active-senior-net.com, ecic.online, eco-rns.com, micmacsttropez.net, beltimpex.com, clairdelunerosporden.com, authormx.com, distanciationsociale.ca, viperbestass.com, sidehustlesavior.com, disus.net, haciendalasadelitas.com, findmythoughts.com, findnowi.com, findwalks.com, findyourhappinesstest.com, the-sample-design.com, the51x.com",
"results": [
{
"num": 1,
"domain_name": "ce.or.kr",
"domain_keyword": "ce",
"domain_tld": "or.kr",
"query_time": "2021-03-21 07:39:30",
"create_date": "2020-04-08",
"update_date": "2020-04-08",
"expiry_date": "2025-04-08",
"registrar_name": "(?)???",
"registrar_website": "http://www.gabia.co.kr",
"registrant_name": "????? ?????",
"registrant_address": "???? ??? ??? ??? 298 ????? (50-208) 298, Daeseong-ro, Cheongwon-gu, Cheongju-si, Chungcheongbuk-do,",
"registrant_zip": "28503"
},
{
"num": 2,
"domain_name": "onmoving.co.kr",
"domain_keyword": "onmoving",
"domain_tld": "co.kr",
"query_time": "2021-07-07 18:27:37",
"create_date": "2020-04-08",
"update_date": "2021-03-22",
"expiry_date": "2024-04-08",
"registrar_name": "(?)???",
"registrar_website": "http://www.gabia.co.kr",
"registrant_name": "?????",
"registrant_address": "????? ??? ???24? 26 B? 821?(???,??????????????????) 26, Beotkkot-ro 24-gil, Geumcheon-gu, Seoul,",
"registrant_zip": "08517"
},
{
"num": 3,
"domain_name": "indiehouse.co.kr",
"domain_keyword": "indiehouse",
"domain_tld": "co.kr",
"query_time": "2022-01-01 17:19:11",
"create_date": "2020-04-08",
"update_date": "2020-04-08",
"expiry_date": "2025-04-08",
"registrar_name": "(?)???",
"registrar_website": "http://www.gabia.co.kr",
"registrant_name": "??????? ?????",
"registrant_address": "??? ??? ??? 2041 ??? 2041, Gyeonggang-ro, Gangneung-si, Gangwon-do,",
"registrant_zip": "25534"
},
{
"num": 4,
"domain_name": "mainstreet.co.kr",
"domain_keyword": "mainstreet",
"domain_tld": "co.kr",
"query_time": "2022-02-20 18:00:11",
"create_date": "2020-04-08",
"update_date": "2021-03-03",
"expiry_date": "2030-04-08",
"registrar_name": "(?)???",
"registrar_website": "http://www.gabia.co.kr",
"registrant_name": "??? ???",
"registrant_address": "??? ??? ??? ????? 660, ?????1 B? 4? , Seongnam-si, Gyeonggi-do U-Space1 Complex B, 4F, 660, Daewangpangyo-ro, Bundang-gu,",
"registrant_zip": "13494"
},
{
"num": 5,
"domain_name": "tiny.my.id",
"domain_keyword": "tiny",
"domain_tld": "my.id",
"query_time": "2022-04-08 06:21:20",
"create_date": "2020-04-08",
"update_date": "2022-03-30",
"expiry_date": "2024-04-08",
"domain_status": [
"clientTransferProhibited"
]
},
{
"num": 6,
"domain_name": "kwskg.or.kr",
"domain_keyword": "kwskg",
"domain_tld": "or.kr",
"query_time": "2022-05-29 12:52:13",
"create_date": "2020-04-08",
"update_date": "2020-04-08",
"expiry_date": "2025-04-08",
"registrar_name": "(?)???",
"registrar_website": "http://www.gabia.co.kr",
"registrant_name": "??????",
"registrant_address": "??? ???? ???32?? 30 ?????? 30, Ipseok-ro 32beon-gil, Uijeongbu-si, Gyeonggi-do,",
"registrant_zip": "11601"
},
{
"num": 7,
"domain_name": "nuteco.uz",
"domain_keyword": "nuteco",
"domain_tld": "uz",
"query_time": "2022-06-02 08:23:53",
"create_date": "2020-04-08",
"update_date": "2022-03-25",
"expiry_date": "2024-04-08",
"registrar_name": "BILLURCOM",
"name_servers": [
"not.defined",
"ns.megagroup.ru",
"ns1.megagroup.ru",
"ns2.megagroup.ru"
],
"domain_status": [
"ACTIVE"
]
},
{
"num": 8,
"domain_name": "recettesdecuisine.ma",
"domain_keyword": "recettesdecuisine",
"domain_tld": "ma",
"query_time": "2022-06-02 15:24:47",
"create_date": "2020-04-08",
"update_date": "2022-04-02",
"expiry_date": "2024-04-08",
"registrar_name": "MEGALOGI",
"registrant_name": "Fatima Zahra LAMOUALDI",
"name_servers": [
"anuj.ns.cloudflare.com",
"barbara.ns.cloudflare.com"
],
"domain_status": [
"ok"
]
},
{
"num": 9,
"domain_name": "ptgbk.co.id",
"domain_keyword": "ptgbk",
"domain_tld": "co.id",
"query_time": "2022-06-03 06:13:42",
"create_date": "2020-04-08",
"update_date": "2022-05-23",
"expiry_date": "2024-04-08",
"domain_status": [
"clientTransferProhibited"
]
},
{
"num": 10,
"domain_name": "componentsonly.mn",
"domain_keyword": "componentsonly",
"domain_tld": "mn",
"query_time": "2022-06-08 19:46:52",
"create_date": "2020-04-08",
"update_date": "2022-03-03",
"expiry_date": "2024-04-08",
"registrar_iana": 119,
"registrar_name": "Datacom Co., Ltd.",
"registrar_website": "whois.nic.mn",
"registrant_name": "Adrian Vinnicombe",
"registrant_company": "United Media Works",
"registrant_address": "PO Box 2078",
"registrant_city": "Milton",
"registrant_state": "Queensland",
"registrant_zip": "4064",
"registrant_country": "AU",
"registrant_email": "[email protected]",
"registrant_phone": "+61.737081360",
"name_servers": [
"ns1.umw-dns.net",
"ns2.umw-dns.net"
],
"domain_status": [
"clientTransferProhibited"
]
},
{
"num": 11,
"domain_name": "samehada.my.id",
"domain_keyword": "samehada",
"domain_tld": "my.id",
"query_time": "2022-06-11 18:58:28",
"create_date": "2020-04-08",
"update_date": "2021-12-12",
"expiry_date": "2025-04-08",
"domain_status": [
"ok"
]
},
{
"num": 12,
"domain_name": "chatoire.re",
"domain_keyword": "chatoire",
"domain_tld": "re",
"query_time": "2022-06-12 03:17:52",
"create_date": "2020-04-08",
"update_date": "2022-05-02",
"expiry_date": "2024-04-08",
"registrar_name": "GANDI",
"registrant_name": "CENTRE COMMERCIAL DU TAMPON 2",
"registrant_address": "CENTRE COMMERCIAL DU TAMPON 2 9 rue D'Italie Zac La Chatoire 97430 Le Tampon",
"registrant_country": "FR",
"registrant_email": "[email protected]",
"registrant_phone": "+262.262579393",
"name_servers": [
"ns-214-a.gandi.net",
"ns-233-c.gandi.net",
"ns-64-b.gandi.net"
],
"domain_status": [
"ACTIVE"
]
},
{
"num": 13,
"domain_name": "galmaemot.or.kr",
"domain_keyword": "galmaemot",
"domain_tld": "or.kr",
"query_time": "2022-06-13 15:41:55",
"create_date": "2020-04-08",
"update_date": "2020-04-08",
"expiry_date": "2025-04-08",
"registrar_name": "(?)???",
"registrar_website": "http://www.gabia.co.kr",
"registrant_name": "???????",
"registrant_address": "???? ??? ??? ????? 610 ??? ???? ??????? 610 Ocheonhaean-ro Ocheon-myeon Boryeong-si Chungcheongnam-do, .",
"registrant_zip": "33406"
},
{
"num": 14,
"domain_name": "vitamilk.uz",
"domain_keyword": "vitamilk",
"domain_tld": "uz",
"query_time": "2022-07-02 06:38:44",
"create_date": "2020-04-08",
"update_date": "2021-07-14",
"expiry_date": "2026-04-08",
"registrar_name": "BILLURCOM",
"name_servers": [
"not.defined",
"ns1.beget.com",
"ns2.beget.com"
],
"domain_status": [
"ACTIVE"
]
},
{
"num": 15,
"domain_name": "syfens.ma",
"domain_keyword": "syfens",
"domain_tld": "ma",
"query_time": "2022-07-03 04:52:45",
"create_date": "2020-04-08",
"update_date": "2022-02-11",
"expiry_date": "2024-04-08",
"registrar_name": "CREATIVE INTERNET SOLUTIONS",
"registrant_name": "Salima Khattabi",
"name_servers": [
"ns1.stackdns.com",
"ns10.vala-bleu.ma",
"ns2.stackdns.com",
"ns3.stackdns.com",
"ns4.stackdns.com"
],
"domain_status": [
"ok"
]
},
{
"num": 16,
"domain_name": "avsystem.ma",
"domain_keyword": "avsystem",
"domain_tld": "ma",
"query_time": "2023-03-05 12:52:32",
"create_date": "2020-04-08",
"update_date": "2023-01-05",
"expiry_date": "2024-04-08",
"registrar_name": "CREATIVE INTERNET SOLUTIONS",
"registrant_name": "AVSYSTEM",
"name_servers": [
"ns1.stackdns.com",
"ns2.stackdns.com",
"ns3.stackdns.com",
"ns4.stackdns.com"
],
"domain_status": [
"ok"
]
},
{
"num": 17,
"domain_name": "viz.sc",
"domain_keyword": "viz",
"domain_tld": "sc",
"query_time": "2023-11-01 00:54:23",
"create_date": "2020-04-08",
"update_date": "2023-03-21",
"expiry_date": "2024-04-08",
"registrar_iana": 800171,
"registrar_name": "VCS Pty Ltd",
"registrant_name": "REDACTED FOR PRIVACY",
"registrant_address": "REDACTED FOR PRIVACY",
"registrant_city": "REDACTED FOR PRIVACY",
"registrant_zip": "REDACTED FOR PRIVACY",
"registrant_country": "US",
"registrant_email": "please query the rdds service of the registrar of record identified in this output for information on how to contact the registrant, admin, or tech contact of the queried domain name.",
"registrant_phone": "REDACTED FOR PRIVACY",
"registrant_fax": "REDACTED FOR PRIVACY",
"name_servers": [
"ns1.digitalocean.com",
"ns2.digitalocean.com",
"ns3.digitalocean.com"
],
"domain_status": [
"ok"
],
"dns_sec": [
"unsigned"
]
},
{
"num": 18,
"domain_name": "pts.ms",
"domain_keyword": "pts",
"domain_tld": "ms",
"query_time": "2023-12-24 19:04:36",
"create_date": "2020-04-08",
"update_date": "2023-01-10",
"expiry_date": "2026-04-08",
"registrar_name": "Key-Systems",
"registrant_name": "Redacted | EU Registrar",
"registrant_company": "PTS Consulting",
"registrant_address": "19-133 14 Taikoowan Road, Tai Koo",
"registrant_city": "Quarry Bay",
"registrant_state": "HKSAR",
"registrant_zip": "0000",
"registrant_country": "HK",
"registrant_email": "redacted | eu registrar",
"registrant_phone": "Redacted | EU Registrar",
"name_servers": [
"ns37.domaincontrol.com",
"ns38.domaincontrol.com"
],
"domain_status": [
"ok"
],
"dns_sec": [
"unsigned"
]
},
{
"num": 19,
"domain_name": "zamowmaterac.pl",
"domain_keyword": "zamowmaterac",
"domain_tld": "pl",
"query_time": "2024-01-20 19:38:10",
"create_date": "2020-04-08",
"update_date": "2023-09-29",
"expiry_date": "2024-04-08",
"registrar_name": "dhosting.pl Sp. z o.o.",
"registrar_website": "http://dhosting.pl/kontakt",
"name_servers": [
"jon.quicns.com",
"kevin.quicns.com"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 20,
"domain_name": "wybrednamaruda.pl",
"domain_keyword": "wybrednamaruda",
"domain_tld": "pl",
"query_time": "2024-02-07 23:00:11",
"create_date": "2020-04-08",
"update_date": "2023-04-02",
"expiry_date": "2024-04-08",
"registrar_name": "OVH SAS",
"registrar_website": "https://www.ovhcloud.com",
"name_servers": [
"dns16.ovh.net",
"ns16.ovh.net"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 21,
"domain_name": "sts-tv.pl",
"domain_keyword": "sts-tv",
"domain_tld": "pl",
"query_time": "2024-02-15 03:04:16",
"create_date": "2020-04-08",
"update_date": "2023-11-22",
"expiry_date": "2024-04-08",
"registrar_name": "Aftermarket.pl Limited",
"registrar_website": "http://www.AfterMarket.pl/contact.php",
"name_servers": [
"ns1.aftermarket.pl",
"ns2.aftermarket.pl"
],
"dns_sec": [
"Signed"
]
},
{
"num": 22,
"domain_name": "koloseo.pl",
"domain_keyword": "koloseo",
"domain_tld": "pl",
"query_time": "2024-02-16 06:14:21",
"create_date": "2020-04-08",
"update_date": "2023-04-06",
"expiry_date": "2024-04-08",
"registrar_name": "dhosting.pl Sp. z o.o.",
"registrar_website": "http://dhosting.pl/kontakt",
"name_servers": [
"ns1.dhosting.pl",
"ns2.dhosting.pl"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 23,
"domain_name": "jaroszmiroslaw.pl",
"domain_keyword": "jaroszmiroslaw",
"domain_tld": "pl",
"query_time": "2024-02-16 19:11:23",
"create_date": "2020-04-08",
"update_date": "2023-03-12",
"expiry_date": "2024-04-08",
"registrar_name": "OVH SAS",
"registrar_website": "https://www.ovhcloud.com",
"name_servers": [
"dns16.ovh.net",
"ns16.ovh.net"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 24,
"domain_name": "urzeczegassy.pl",
"domain_keyword": "urzeczegassy",
"domain_tld": "pl",
"query_time": "2024-02-17 15:07:13",
"create_date": "2020-04-08",
"update_date": "2023-04-03",
"expiry_date": "2024-04-08",
"registrar_name": "cyber_Folks S.A.",
"name_servers": [
"ns1.kei.pl",
"ns2.kei.pl"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 25,
"domain_name": "fundacjapoz.pl",
"domain_keyword": "fundacjapoz",
"domain_tld": "pl",
"query_time": "2024-02-20 15:50:03",
"create_date": "2020-04-08",
"update_date": "2023-04-13",
"expiry_date": "2024-04-08",
"registrar_name": "nazwa.pl sp. z o.o.",
"registrar_website": "www.nazwa.pl",
"name_servers": [
"ns1.nazwa.pl",
"ns2.nazwa.pl",
"ns3.nazwa.pl"
],
"dns_sec": [
"Signed"
]
},
{
"num": 26,
"domain_name": "tomekflorja.pl",
"domain_keyword": "tomekflorja",
"domain_tld": "pl",
"query_time": "2024-02-21 08:51:56",
"create_date": "2020-04-08",
"update_date": "2023-04-03",
"expiry_date": "2024-04-08",
"registrar_name": "LH.pl Sp. z o.o.",
"registrar_website": "https://www.lh.pl/",
"name_servers": [
"ns.lh.pl",
"ns2.lighthosting.net"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 27,
"domain_name": "przewozyberlinski.pl",
"domain_keyword": "przewozyberlinski",
"domain_tld": "pl",
"query_time": "2024-03-01 18:01:49",
"create_date": "2020-04-08",
"update_date": "2022-12-21",
"expiry_date": "2026-04-08",
"registrar_name": "Consulting Service Sp. z o.o.",
"name_servers": [
"ns1.i-host.pl",
"ns2.i-host.pl"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 28,
"domain_name": "sklepklasa.pl",
"domain_keyword": "sklepklasa",
"domain_tld": "pl",
"query_time": "2024-03-03 16:16:04",
"create_date": "2020-04-08",
"update_date": "2023-04-09",
"expiry_date": "2024-04-08",
"registrar_name": "OVH SAS",
"registrar_website": "https://www.ovhcloud.com",
"dns_sec": [
"Unsigned"
]
},
{
"num": 29,
"domain_name": "polishpremium.pl",
"domain_keyword": "polishpremium",
"domain_tld": "pl",
"query_time": "2024-03-03 22:11:10",
"create_date": "2020-04-08",
"update_date": "2022-02-16",
"expiry_date": "2025-04-08",
"registrar_name": "OVH SAS",
"registrar_website": "https://www.ovhcloud.com",
"name_servers": [
"dns16.ovh.net",
"ns16.ovh.net"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 30,
"domain_name": "apartamentyrajcza.pl",
"domain_keyword": "apartamentyrajcza",
"domain_tld": "pl",
"query_time": "2024-03-04 04:42:51",
"create_date": "2020-04-08",
"update_date": "2023-04-08",
"expiry_date": "2024-04-08",
"registrar_name": "Smarthost Sp. z o.o.",
"name_servers": [
"dns.smarthost.pl",
"dns2.smarthost.pl",
"dns3.smarthost.pl"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 31,
"domain_name": "xn--podruje-o0a74j.pl",
"domain_keyword": "xn--podruje-o0a74j",
"domain_tld": "pl",
"query_time": "2024-03-04 18:26:46",
"create_date": "2020-04-08",
"update_date": "2022-10-11",
"expiry_date": "2024-04-08",
"registrar_name": "Aftermarket.pl Limited",
"registrar_website": "http://www.AfterMarket.pl/contact.php",
"name_servers": [
"ns1.parkingcrew.net",
"ns2.parkingcrew.net"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 32,
"domain_name": "kasztanowapark.pl",
"domain_keyword": "kasztanowapark",
"domain_tld": "pl",
"query_time": "2024-03-05 06:56:12",
"create_date": "2020-04-08",
"update_date": "2023-07-25",
"expiry_date": "2025-04-08",
"registrar_name": "OVH SAS",
"registrar_website": "https://www.ovhcloud.com",
"name_servers": [
"dns16.ovh.net",
"ns16.ovh.net"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 33,
"domain_name": "agnieszkagebusia.pl",
"domain_keyword": "agnieszkagebusia",
"domain_tld": "pl",
"query_time": "2024-03-06 19:19:08",
"create_date": "2020-04-08",
"update_date": "2023-04-05",
"expiry_date": "2024-04-08",
"registrar_name": "LH.pl Sp. z o.o.",
"registrar_website": "https://www.lh.pl/",
"name_servers": [
"ns.lh.pl",
"ns2.lighthosting.net"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 34,
"domain_name": "wiktorkowalski.pl",
"domain_keyword": "wiktorkowalski",
"domain_tld": "pl",
"query_time": "2024-03-07 13:03:26",
"create_date": "2020-04-08",
"update_date": "2023-06-09",
"expiry_date": "2025-04-08",
"registrar_name": "OVH SAS",
"registrar_website": "https://www.ovhcloud.com",
"name_servers": [
"ns-1527.awsdns-62.org",
"ns-1576.awsdns-05.co.uk",
"ns-195.awsdns-24.com",
"ns-917.awsdns-50.net"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 35,
"domain_name": "notariuszegdynia.pl",
"domain_keyword": "notariuszegdynia",
"domain_tld": "pl",
"query_time": "2024-03-07 16:23:26",
"create_date": "2020-04-08",
"update_date": "2023-03-21",
"expiry_date": "2024-04-08",
"registrar_name": "home.pl S.A.",
"registrar_website": "https://home.pl/kontakt",
"name_servers": [
"dns.home.pl",
"dns2.home.pl",
"dns3.home.pl"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 36,
"domain_name": "brylcar.pl",
"domain_keyword": "brylcar",
"domain_tld": "pl",
"query_time": "2024-03-07 22:09:00",
"create_date": "2020-04-08",
"update_date": "2023-02-24",
"expiry_date": "2026-04-08",
"registrar_name": "Consulting Service Sp. z o.o.",
"name_servers": [
"ns1.i-host.pl",
"ns2.i-host.pl"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 37,
"domain_name": "mwinstal.pl",
"domain_keyword": "mwinstal",
"domain_tld": "pl",
"query_time": "2024-03-09 10:32:21",
"create_date": "2020-04-08",
"update_date": "2024-03-06",
"expiry_date": "2029-04-08",
"registrar_name": "OVH SAS",
"registrar_website": "https://www.ovhcloud.com",
"name_servers": [
"dns11.ovh.net",
"ns11.ovh.net"
],
"dns_sec": [
"Signed"
]
},
{
"num": 38,
"domain_name": "ekojudecki.pl",
"domain_keyword": "ekojudecki",
"domain_tld": "pl",
"query_time": "2024-03-09 14:11:27",
"create_date": "2020-04-08",
"update_date": "2023-04-04",
"expiry_date": "2024-04-08",
"registrar_name": "OVH SAS",
"registrar_website": "https://www.ovhcloud.com",
"name_servers": [
"ns1.seohost.pl",
"ns2.seohost.pl"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 39,
"domain_name": "nwstal.pl",
"domain_keyword": "nwstal",
"domain_tld": "pl",
"query_time": "2024-03-09 15:21:21",
"create_date": "2020-04-08",
"update_date": "2023-02-22",
"expiry_date": "2025-04-08",
"registrar_name": "home.pl S.A.",
"registrar_website": "https://home.pl/kontakt",
"name_servers": [
"dns.home.pl",
"dns2.home.pl",
"dns3.home.pl"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 40,
"domain_name": "meblearino.pl",
"domain_keyword": "meblearino",
"domain_tld": "pl",
"query_time": "2024-03-09 19:22:14",
"create_date": "2020-04-08",
"update_date": "2023-03-27",
"expiry_date": "2024-04-08",
"registrar_name": "AZ.pl Sp. z o.o.",
"name_servers": [
"ns1.dcsaas.net",
"ns2.dcsaas.net"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 41,
"domain_name": "skleppm.pl",
"domain_keyword": "skleppm",
"domain_tld": "pl",
"query_time": "2024-03-10 02:40:46",
"create_date": "2020-04-08",
"update_date": "2023-03-28",
"expiry_date": "2024-04-08",
"registrar_name": "cyber_Folks S.A.",
"name_servers": [
"ns1.dcsaas.net",
"ns2.dcsaas.net"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 42,
"domain_name": "symbicortturbuhaler.co.uk",
"domain_keyword": "symbicortturbuhaler",
"domain_tld": "co.uk",
"query_time": "2024-03-10 09:05:39",
"create_date": "2020-04-08",
"update_date": "2024-03-09",
"expiry_date": "2025-04-08",
"registrar_name": "Nom-IQ Limited t/a Com Laude [Tag = NOMIQ]",
"registrar_website": "https://comlaude.com",
"name_servers": [
"dns1.comlaude-dns.com",
"dns2.comlaude-dns.net",
"dns3.comlaude-dns.co.uk",
"dns4.comlaude-dns.eu"
],
"domain_status": [
"Registered until expiry date."
]
},
{
"num": 43,
"domain_name": "zappatos.uk",
"domain_keyword": "zappatos",
"domain_tld": "uk",
"query_time": "2024-03-11 06:52:20",
"create_date": "2020-04-08",
"update_date": "2024-03-07",
"expiry_date": "2025-04-08",
"registrar_name": "MARCARIA.COM International Inc [Tag = MARCARIA-US]",
"registrar_website": "https://www.marcaria.com/uk",
"name_servers": [
"lewis.ns.cloudflare.com",
"raquel.ns.cloudflare.com"
],
"domain_status": [
"Registered until expiry date."
]
},
{
"num": 44,
"domain_name": "car-man.pl",
"domain_keyword": "car-man",
"domain_tld": "pl",
"query_time": "2024-03-11 21:50:17",
"create_date": "2020-04-08",
"update_date": "2022-10-25",
"expiry_date": "2025-04-08",
"registrar_name": "Consulting Service Sp. z o.o.",
"name_servers": [
"ns1.i-host.pl",
"ns2.i-host.pl"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 45,
"domain_name": "polisa-grupowa.pl",
"domain_keyword": "polisa-grupowa",
"domain_tld": "pl",
"query_time": "2024-03-12 21:02:12",
"create_date": "2020-04-08",
"update_date": "2023-04-03",
"expiry_date": "2024-04-08",
"registrar_name": "nazwa.pl sp. z o.o.",
"registrar_website": "www.nazwa.pl",
"name_servers": [
"ns1.nazwa.pl",
"ns2.nazwa.pl",
"ns3.nazwa.pl"
],
"dns_sec": [
"Signed"
]
},
{
"num": 46,
"domain_name": "ptsm.com.pl",
"domain_keyword": "ptsm",
"domain_tld": "com.pl",
"query_time": "2024-03-13 03:00:36",
"create_date": "2020-04-08",
"update_date": "2023-04-05",
"expiry_date": "2024-04-08",
"registrar_name": "nazwa.pl sp. z o.o.",
"registrar_website": "www.nazwa.pl",
"name_servers": [
"eucalyptus.am.poznan.pl",
"sequoia.am.poznan.pl"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 47,
"domain_name": "caigatetex.co.uk",
"domain_keyword": "caigatetex",
"domain_tld": "co.uk",
"query_time": "2024-03-13 09:22:02",
"create_date": "2020-04-08",
"update_date": "2023-12-20",
"expiry_date": "2025-04-08",
"registrar_name": "123-Reg Limited t/a 123-reg [Tag = 123-REG]",
"registrar_website": "https://www.123-reg.co.uk",
"name_servers": [
"ns3.codetrix.co.uk",
"ns4.codetrix.co.uk"
],
"domain_status": [
"Registered until expiry date."
]
},
{
"num": 48,
"domain_name": "poradnikzwiazkowca.pl",
"domain_keyword": "poradnikzwiazkowca",
"domain_tld": "pl",
"query_time": "2024-03-13 17:28:38",
"create_date": "2020-04-08",
"update_date": "2023-03-21",
"expiry_date": "2024-04-08",
"registrar_name": "LH.pl Sp. z o.o.",
"registrar_website": "https://www.lh.pl/",
"name_servers": [
"ns.lh.pl",
"ns2.lighthosting.net"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 49,
"domain_name": "mojelektryk.pl",
"domain_keyword": "mojelektryk",
"domain_tld": "pl",
"query_time": "2024-03-14 08:01:17",
"create_date": "2020-04-08",
"update_date": "2023-04-06",
"expiry_date": "2024-04-08",
"registrar_name": "cyber_Folks S.A.",
"name_servers": [
"ns1.premium.pl",
"ns2.premium.pl"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 50,
"domain_name": "colorfolk.pl",
"domain_keyword": "colorfolk",
"domain_tld": "pl",
"query_time": "2024-03-14 22:12:26",
"create_date": "2020-04-08",
"update_date": "2023-10-25",
"expiry_date": "2024-04-08",
"registrar_name": "home.pl S.A.",
"registrar_website": "https://home.pl/kontakt",
"name_servers": [
"ns1.iq.pl",
"ns2.iq.pl"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 51,
"domain_name": "pracownicyzfilipin.pl",
"domain_keyword": "pracownicyzfilipin",
"domain_tld": "pl",
"query_time": "2024-03-15 19:11:35",
"create_date": "2020-04-08",
"update_date": "2023-04-05",
"expiry_date": "2024-04-08",
"registrar_name": "PERSKIMEDIA Szymon Perski",
"name_servers": [
"dns1.microhost.pl",
"dns2.microhost.pl"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 52,
"domain_name": "wygodnakanapa.pl",
"domain_keyword": "wygodnakanapa",
"domain_tld": "pl",
"query_time": "2024-03-16 00:15:41",
"create_date": "2020-04-08",
"update_date": "2023-04-12",
"expiry_date": "2024-04-08",
"registrar_name": "OVH SAS",
"registrar_website": "https://www.ovhcloud.com",
"name_servers": [
"dns16.ovh.net",
"ns16.ovh.net"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 53,
"domain_name": "wartkaakcja.pl",
"domain_keyword": "wartkaakcja",
"domain_tld": "pl",
"query_time": "2024-03-16 00:58:07",
"create_date": "2020-04-08",
"update_date": "2023-03-17",
"expiry_date": "2024-04-08",
"registrar_name": "LH.pl Sp. z o.o.",
"registrar_website": "https://www.lh.pl/",
"name_servers": [
"ns.lh.pl",
"ns2.lighthosting.net"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 54,
"domain_name": "polcrane.pl",
"domain_keyword": "polcrane",
"domain_tld": "pl",
"query_time": "2024-03-16 05:25:11",
"create_date": "2020-04-08",
"update_date": "2024-03-10",
"expiry_date": "2024-04-08",
"registrar_name": "Consulting Service Sp. z o.o.",
"name_servers": [
"ns1.tittle.pl",
"ns2.tittle.pl"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 55,
"domain_name": "pomponkomis.pl",
"domain_keyword": "pomponkomis",
"domain_tld": "pl",
"query_time": "2024-03-16 05:29:06",
"create_date": "2020-04-08",
"update_date": "2023-03-29",
"expiry_date": "2024-04-08",
"registrar_name": "AZ.pl Sp. z o.o.",
"name_servers": [
"ns1.dcsaas.net",
"ns2.dcsaas.net"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 56,
"domain_name": "galeriakochanestarocie.pl",
"domain_keyword": "galeriakochanestarocie",
"domain_tld": "pl",
"query_time": "2024-03-16 19:11:19",
"create_date": "2020-04-08",
"update_date": "2023-04-05",
"expiry_date": "2024-04-08",
"registrar_name": "home.pl S.A.",
"registrar_website": "https://home.pl/kontakt",
"name_servers": [
"dns.home.pl",
"dns2.home.pl",
"dns3.home.pl"
],
"dns_sec": [
"Signed"
]
},
{
"num": 57,
"domain_name": "printtime.co.uk",
"domain_keyword": "printtime",
"domain_tld": "co.uk",
"query_time": "2024-03-17 07:02:10",
"create_date": "2020-04-08",
"update_date": "2023-06-09",
"expiry_date": "2024-04-08",
"registrar_name": "Garth Piesse [Tag = COHERENT-NZ]",
"name_servers": [
"ns1.eftydns.com",
"ns2.eftydns.com"
],
"domain_status": [
"Registered until expiry date."
]
},
{
"num": 58,
"domain_name": "dekarz-katowice.pl",
"domain_keyword": "dekarz-katowice",
"domain_tld": "pl",
"query_time": "2024-03-17 23:20:01",
"create_date": "2020-04-08",
"update_date": "2023-01-17",
"expiry_date": "2026-04-08",
"registrar_name": "Consulting Service Sp. z o.o.",
"name_servers": [
"ns1.i-host.pl",
"ns2.i-host.pl"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 59,
"domain_name": "anticoasianexell.com",
"domain_keyword": "anticoasianexell",
"domain_tld": "com",
"query_time": "2024-03-19 00:01:14",
"create_date": "2020-04-08",
"update_date": "2023-03-27",
"expiry_date": "2026-04-08",
"registrar_iana": 100,
"registrar_name": "Whois Corp.",
"registrar_website": "http://www.whois.co.kr",
"registrant_name": "CoAsia Corporation",
"registrant_company": "CoAsia Corporation",
"registrant_address": "67 Jeongui-ro Songpa-gu Seoul Korea",
"registrant_city": "7F",
"registrant_zip": "05835",
"registrant_country": "KR",
"registrant_email": "[email protected]",
"registrant_phone": "+82.3151708114",
"name_servers": [
"ns1.whoisdomain.kr",
"ns2.whoisdomain.kr",
"ns3.whoisdomain.kr",
"ns4.whoisdomain.kr"
],
"domain_status": [
"clientTransferProhibited"
],
"dns_sec": [
"unsigned"
]
},
{
"num": 60,
"domain_name": "whozzbuy.com",
"domain_keyword": "whozzbuy",
"domain_tld": "com",
"query_time": "2024-03-19 00:06:51",
"create_date": "2020-04-08",
"update_date": "2024-03-05",
"expiry_date": "2025-04-08",
"registrar_iana": 1479,
"registrar_name": "NameSilo, LLC",
"registrar_website": "https://www.namesilo.com/",
"registrant_name": "REDACTED FOR PRIVACY",
"registrant_company": "See PrivacyGuardian.org",
"registrant_address": "1928 E. Highland Ave. Ste F104 PMB# 255",
"registrant_city": "Phoenix",
"registrant_state": "AZ",
"registrant_zip": "85016",
"registrant_country": "US",
"registrant_email": "[email protected]",
"registrant_phone": "+1.3478717726",
"name_servers": [
"ns1.cannki.com",
"ns2.cannki.com"
],
"domain_status": [
"clientTransferProhibited"
],
"dns_sec": [
"unsigned"
]
},
{
"num": 61,
"domain_name": "ctfireblade.com",
"domain_keyword": "ctfireblade",
"domain_tld": "com",
"query_time": "2024-03-19 00:07:11",
"create_date": "2020-04-08",
"update_date": "2024-02-28",
"expiry_date": "2025-04-08",
"registrar_iana": 303,
"registrar_name": "PDR Ltd. d/b/a PublicDomainRegistry.com",
"registrar_website": "www.publicdomainregistry.com",
"registrant_name": "Domain Admin",
"registrant_company": "Privacy Protect, LLC (PrivacyProtect.org)",
"registrant_address": "10 Corporate Drive",
"registrant_city": "Burlington",
"registrant_state": "MA",
"registrant_zip": "01803",
"registrant_country": "US",
"registrant_email": "[email protected]",
"registrant_phone": "+1.8022274003",
"name_servers": [
"ns1.reservado.hostgator.com.br",
"ns2.reservado.hostgator.com.br"
],
"domain_status": [
"clientTransferProhibited"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 62,
"domain_name": "komurodesignhouse.com",
"domain_keyword": "komurodesignhouse",
"domain_tld": "com",
"query_time": "2024-03-19 00:19:26",
"create_date": "2020-04-08",
"update_date": "2024-03-08",
"expiry_date": "2025-04-08",
"registrar_iana": 431,
"registrar_name": "DREAMHOST",
"registrar_website": "WWW.DREAMHOST.COM",
"registrant_name": "Proxy Protection LLC",
"registrant_company": "Proxy Protection LLC",
"registrant_address": "417 Associated Rd #327, C/O komurodesignhouse.com",
"registrant_city": "Brea",
"registrant_state": "CA",
"registrant_zip": "92821",
"registrant_country": "US",
"registrant_email": "[email protected]",
"registrant_phone": "+1.7147064182",
"name_servers": [
"ns1.dreamhost.com",
"ns2.dreamhost.com",
"ns3.dreamhost.com"
],
"domain_status": [
"clientTransferProhibited"
],
"dns_sec": [
"unsigned"
]
},
{
"num": 63,
"domain_name": "apmfs.com",
"domain_keyword": "apmfs",
"domain_tld": "com",
"query_time": "2024-03-19 00:25:35",
"create_date": "2020-04-08",
"update_date": "2021-04-02",
"expiry_date": "2025-04-08",
"registrar_iana": 1441,
"registrar_name": "TurnCommerce, Inc. DBA NameBright.com",
"registrar_website": "https://www.NameBright.com",
"registrant_name": "Domain Admin / This Domain is For Sale",
"registrant_company": "HugeDomains.com",
"registrant_address": "2635 Walnut Street",
"registrant_city": "Denver",
"registrant_state": "CO",
"registrant_zip": "80205",
"registrant_country": "US",
"registrant_email": "[email protected]",
"registrant_phone": "+1.3038930552",
"name_servers": [
"nsg1.namebrightdns.com",
"nsg2.namebrightdns.com"
],
"domain_status": [
"clientTransferProhibited"
],
"dns_sec": [
"unsigned"
]
},
{
"num": 64,
"domain_name": "tatsu.ninja",
"domain_keyword": "tatsu",
"domain_tld": "ninja",
"query_time": "2024-03-19 00:28:16",
"create_date": "2020-04-08",
"update_date": "2023-07-16",
"expiry_date": "2025-04-08",
"registrar_iana": 146,
"registrar_name": "GoDaddy.com, LLC",
"registrar_website": "http://www.godaddy.com/domains/search.aspx?ci=8990",
"registrant_name": "REDACTED FOR PRIVACY",
"registrant_company": "Domains By Proxy, LLC",
"registrant_address": "REDACTED FOR PRIVACY",
"registrant_city": "REDACTED FOR PRIVACY",
"registrant_state": "Arizona",
"registrant_zip": "REDACTED FOR PRIVACY",
"registrant_country": "US",
"registrant_email": "please query the rdds service of the registrar of record identified in this output for information on how to contact the registrant, admin, or tech contact of the queried domain name.",
"registrant_phone": "REDACTED FOR PRIVACY",
"registrant_fax": "REDACTED FOR PRIVACY",
"name_servers": [
"ns39.domaincontrol.com",
"ns40.domaincontrol.com"
],
"domain_status": [
"clientDeleteProhibited",
"clientRenewProhibited",
"clientTransferProhibited",
"clientUpdateProhibited"
],
"dns_sec": [
"unsigned"
]
},
{
"num": 65,
"domain_name": "i-pinky-swear.com",
"domain_keyword": "i-pinky-swear",
"domain_tld": "com",
"query_time": "2024-03-19 00:30:24",
"create_date": "2020-04-08",
"update_date": "2024-02-19",
"expiry_date": "2025-04-08",
"registrar_iana": 1647,
"registrar_name": "Hosting Concepts B.V. d/b/a Registrar.eu",
"registrar_website": "https://www.registrar.eu",
"registrant_name": "REDACTED FOR PRIVACY",
"registrant_company": "Parsley Studio's CC",
"registrant_address": "REDACTED FOR PRIVACY",
"registrant_city": "REDACTED FOR PRIVACY",
"registrant_state": "Gauteng",
"registrant_zip": "REDACTED FOR PRIVACY",
"registrant_country": "ZA",
"registrant_email": "https://contact-form.registrar.eu/?domainname=i-pinky-swear.com&purpose=owner",
"registrant_phone": "REDACTED FOR PRIVACY",
"registrant_fax": "REDACTED FOR PRIVACY",
"name_servers": [
"vpsns1.cpt.wa.co.za",
"vpsns2.cpt.wa.co.za"
],
"domain_status": [
"clientTransferProhibited",
"ok"
],
"dns_sec": [
"unsigned"
]
},
{
"num": 66,
"domain_name": "taxhawk.live",
"domain_keyword": "taxhawk",
"domain_tld": "live",
"query_time": "2024-03-19 00:34:27",
"create_date": "2020-04-08",
"update_date": "2024-02-13",
"expiry_date": "2025-04-08",
"registrar_iana": 2,
"registrar_name": "Network Solutions, LLC",
"registrar_website": "http://www.networksolutions.com",
"registrant_name": "REDACTED FOR PRIVACY",
"registrant_company": "TaxHawk, Inc",
"registrant_address": "REDACTED FOR PRIVACY",
"registrant_city": "REDACTED FOR PRIVACY",
"registrant_state": "UT",
"registrant_zip": "REDACTED FOR PRIVACY",
"registrant_country": "US",
"registrant_email": "please query the rdds service of the registrar of record identified in this output for information on how to contact the registrant, admin, or tech contact of the queried domain name.",
"registrant_phone": "REDACTED FOR PRIVACY",
"registrant_fax": "REDACTED FOR PRIVACY",
"name_servers": [
"eve.ns.cloudflare.com",
"yahir.ns.cloudflare.com"
],
"domain_status": [
"clientTransferProhibited"
],
"dns_sec": [
"unsigned"
]
},
{
"num": 67,
"domain_name": "newchungfishchipsandchinesetakeaway.com",
"domain_keyword": "newchungfishchipsandchinesetakeaway",
"domain_tld": "com",
"query_time": "2024-03-19 00:37:24",
"create_date": "2020-04-08",
"update_date": "2024-03-13",
"expiry_date": "2025-04-08",
"registrar_iana": 1910,
"registrar_name": "Cloudflare, Inc.",
"registrar_website": "https://www.cloudflare.com",
"registrant_name": "DATA REDACTED",
"registrant_company": "DATA REDACTED",
"registrant_address": "DATA REDACTED",
"registrant_city": "DATA REDACTED",
"registrant_state": "staffordshire",
"registrant_zip": "DATA REDACTED",
"registrant_country": "GB",
"registrant_email": "https://domaincontact.cloudflareregistrar.com/newchungfishchipsandchinesetakeaway.com",
"registrant_phone": "DATA REDACTED",
"registrant_fax": "DATA REDACTED",
"name_servers": [
"chan.ns.cloudflare.com",
"merlin.ns.cloudflare.com"
],
"domain_status": [
"clientTransferProhibited",
"renewPeriod"
],
"dns_sec": [
"unsigned"
]
},
{
"num": 68,
"domain_name": "ispotdesignexpression.com",
"domain_keyword": "ispotdesignexpression",
"domain_tld": "com",
"query_time": "2024-03-19 00:38:55",
"create_date": "2020-04-08",
"update_date": "2024-03-10",
"expiry_date": "2025-04-08",
"registrar_iana": 48,
"registrar_name": "ENOM, INC.",
"registrar_website": "WWW.ENOMDOMAINS.COM",
"registrant_name": "REDACTED FOR PRIVACY",
"registrant_company": "REDACTED FOR PRIVACY",
"registrant_address": "REDACTED FOR PRIVACY",
"registrant_city": "REDACTED FOR PRIVACY",
"registrant_state": "WA",
"registrant_zip": "REDACTED FOR PRIVACY",
"registrant_country": "US",
"registrant_email": "https://tieredaccess.com/contact/9046a961-d151-48eb-9a01-c80233ee8f3a",
"registrant_phone": "REDACTED FOR PRIVACY",
"registrant_fax": "REDACTED FOR PRIVACY",
"name_servers": [
"ns-1103.awsdns-09.org",
"ns-1677.awsdns-17.co.uk",
"ns-379.awsdns-47.com",
"ns-750.awsdns-29.net"
],
"domain_status": [
"clientTransferProhibited"
],
"dns_sec": [
"unsigned"
]
},
{
"num": 69,
"domain_name": "newfundingupdate.com",
"domain_keyword": "newfundingupdate",
"domain_tld": "com",
"query_time": "2024-03-19 00:39:04",
"create_date": "2020-04-08",
"update_date": "2024-03-05",
"expiry_date": "2025-04-08",
"registrar_iana": 468,
"registrar_name": "Amazon Registrar, Inc.",
"registrar_website": "https://registrar.amazon.com",
"registrant_name": "On behalf of newfundingupdate.com owner",
"registrant_company": "Identity Protection Service",
"registrant_address": "PO Box 786",
"registrant_city": "Hayes",
"registrant_state": "Middlesex",
"registrant_zip": "UB3 9TR",
"registrant_country": "GB",
"registrant_email": "[email protected]",
"registrant_phone": "+44.1483307527",
"registrant_fax": "+44.1483304031",
"name_servers": [
"ns-1050.awsdns-03.org",
"ns-1989.awsdns-56.co.uk",
"ns-84.awsdns-10.com",
"ns-900.awsdns-48.net"
],
"domain_status": [
"ok"
],
"dns_sec": [
"unsigned"
]
},
{
"num": 70,
"domain_name": "sktmanba.com",
"domain_keyword": "sktmanba",
"domain_tld": "com",
"query_time": "2024-03-19 00:48:42",
"create_date": "2020-04-08",
"update_date": "2023-04-08",
"expiry_date": "2028-04-08",
"registrar_iana": 113,
"registrar_name": "CSL Computer Service Langenbach GmbH d/b/a joker.com",
"registrar_website": "https://joker.com",
"registrant_country": "GB",
"registrant_email": "https://csl-registrar.com/contact/sktmanba.com/owner",
"name_servers": [
"wp47.mizbanwp.com",
"wp48.mizbanwp.com"
],
"domain_status": [
"clientTransferProhibited"
],
"dns_sec": [
"unsigned"
]
},
{
"num": 71,
"domain_name": "dentalfocus.org",
"domain_keyword": "dentalfocus",
"domain_tld": "org",
"query_time": "2024-03-19 00:49:13",
"create_date": "2020-04-08",
"update_date": "2024-03-14",
"expiry_date": "2025-04-08",
"registrar_iana": 69,
"registrar_name": "Tucows Domains Inc.",
"registrar_website": "http://www.tucows.com",
"registrant_name": "REDACTED FOR PRIVACY",
"registrant_company": "Sucofocus Ltd",
"registrant_address": "REDACTED FOR PRIVACY",
"registrant_city": "REDACTED FOR PRIVACY",
"registrant_state": "Surrey",
"registrant_zip": "REDACTED FOR PRIVACY",
"registrant_country": "GB",
"registrant_email": "please query the rdds service of the registrar of record identified in this output for information on how to contact the registrant, admin, or tech contact of the queried domain name.",
"registrant_phone": "REDACTED FOR PRIVACY",
"registrant_fax": "REDACTED FOR PRIVACY",
"name_servers": [
"ns1.livedns.co.uk",
"ns2.livedns.co.uk",
"ns3.livedns.co.uk"
],
"domain_status": [
"clientTransferProhibited",
"clientUpdateProhibited"
],
"dns_sec": [
"unsigned"
]
},
{
"num": 72,
"domain_name": "astohapico.co.jp",
"domain_keyword": "astohapico",
"domain_tld": "co.jp",
"query_time": "2024-03-19 00:50:36",
"create_date": "2020-04-08",
"update_date": "2023-05-01",
"registrant_company": "TOPBROSSAN CO.,LTD",
"name_servers": [
"ns1.value-domain.com",
"ns2.value-domain.com"
]
},
{
"num": 73,
"domain_name": "skyfuture.xyz",
"domain_keyword": "skyfuture",
"domain_tld": "xyz",
"query_time": "2024-03-19 00:50:46",
"create_date": "2020-04-08",
"update_date": "2023-08-31",
"expiry_date": "2025-04-08",
"registrar_iana": 1599,
"registrar_name": "Alibaba Cloud Computing Ltd. d/b/a HiChina (www.net.cn)",
"registrant_company": "Shenzhen Skyfuture Film Profuction Co.,Ltd",
"registrant_state": "guang dong",
"registrant_country": "CN",
"registrant_email": "please query the rdds service of the registrar of record identified in this output for information on how to contact the registrant, admin, or tech contact of the queried domain name.",
"name_servers": [
"dns31.hichina.com",
"dns32.hichina.com"
],
"domain_status": [
"ok"
],
"dns_sec": [
"unsigned"
]
},
{
"num": 74,
"domain_name": "thinkaheadfinancial.com",
"domain_keyword": "thinkaheadfinancial",
"domain_tld": "com",
"query_time": "2024-03-19 00:54:15",
"create_date": "2020-04-08",
"update_date": "2024-03-13",
"expiry_date": "2029-04-08",
"registrar_iana": 1375,
"registrar_name": "Register.ca Inc",
"registrar_website": "http://register.ca",
"registrant_name": "Privacy Officer",
"registrant_company": "SafeWhois.ca Whois Privacy Service",
"registrant_address": "5863 Leslie St. Suite 307",
"registrant_city": "Toronto",
"registrant_state": "Ontario",
"registrant_zip": "M2H1J8",
"registrant_country": "CA",
"registrant_email": "[email protected]",
"registrant_phone": "+1.4163857765",
"name_servers": [
"dns1.name-services.com",
"dns2.name-services.com",
"dns3.name-services.com",
"dns4.name-services.com",
"dns5.name-services.com"
],
"domain_status": [
"clientTransferProhibited",
"clientUpdateProhibited"
],
"dns_sec": [
"unsigned"
]
},
{
"num": 75,
"domain_name": "esperanzatoros.org",
"domain_keyword": "esperanzatoros",
"domain_tld": "org",
"query_time": "2024-03-19 01:14:07",
"create_date": "2020-04-08",
"update_date": "2024-03-10",
"expiry_date": "2025-04-08",
"registrar_iana": 468,
"registrar_name": "Amazon Registrar, Inc.",
"registrar_website": "http://registrar.amazon.com",
"registrant_name": "REDACTED FOR PRIVACY",
"registrant_company": "Identity Protection Service",
"registrant_address": "REDACTED FOR PRIVACY",
"registrant_city": "REDACTED FOR PRIVACY",
"registrant_state": "Middlesex",
"registrant_zip": "REDACTED FOR PRIVACY",
"registrant_country": "GB",
"registrant_email": "please query the rdds service of the registrar of record identified in this output for information on how to contact the registrant, admin, or tech contact of the queried domain name.",
"registrant_phone": "REDACTED FOR PRIVACY",
"registrant_fax": "REDACTED FOR PRIVACY",
"name_servers": [
"ns-1256.awsdns-29.org",
"ns-1793.awsdns-32.co.uk",
"ns-395.awsdns-49.com",
"ns-695.awsdns-22.net"
],
"domain_status": [
"ok"
],
"dns_sec": [
"unsigned"
]
},
{
"num": 76,
"domain_name": "innovationhomegroup.com",
"domain_keyword": "innovationhomegroup",
"domain_tld": "com",
"query_time": "2024-03-19 01:18:49",
"create_date": "2020-04-08",
"update_date": "2022-10-10",
"expiry_date": "2025-04-08",
"registrar_iana": 1387,
"registrar_name": "1API GmbH",
"registrar_website": "http://www.1api.net",
"registrant_name": "REDACTED FOR PRIVACY",
"registrant_company": "REDACTED FOR PRIVACY",
"registrant_address": "REDACTED FOR PRIVACY",
"registrant_city": "REDACTED FOR PRIVACY",
"registrant_state": "-",
"registrant_zip": "REDACTED FOR PRIVACY",
"registrant_country": "FI",
"registrant_email": "contact via https://www.1api.net/send-message/innovationhomegroup.com/registrant",
"registrant_phone": "REDACTED FOR PRIVACY",
"name_servers": [
"ns1.domainhotelli.fi",
"ns2.domainhotelli.fi"
],
"domain_status": [
"clientTransferProhibited"
],
"dns_sec": [
"unsigned"
]
},
{
"num": 77,
"domain_name": "innovationhomeshop.com",
"domain_keyword": "innovationhomeshop",
"domain_tld": "com",
"query_time": "2024-03-19 01:18:49",
"create_date": "2020-04-08",
"update_date": "2022-10-10",
"expiry_date": "2025-04-08",
"registrar_iana": 1387,
"registrar_name": "1API GmbH",
"registrar_website": "http://www.1api.net",
"name_servers": [
"ns1.domainhotelli.fi",
"ns2.domainhotelli.fi"
],
"domain_status": [
"clientTransferProhibited"
],
"dns_sec": [
"unsigned"
]
},
{
"num": 78,
"domain_name": "innovationhome.info",
"domain_keyword": "innovationhome",
"domain_tld": "info",
"query_time": "2024-03-19 01:18:49",
"create_date": "2020-04-08",
"update_date": "2022-09-10",
"expiry_date": "2025-04-08",
"registrar_iana": 1387,
"registrar_name": "1API GmbH",
"registrar_website": "http://www.1api.net",
"registrant_name": "REDACTED FOR PRIVACY",
"registrant_company": "Registrant of innovationhome.info",
"registrant_address": "REDACTED FOR PRIVACY",
"registrant_city": "REDACTED FOR PRIVACY",
"registrant_state": "West Yorkshire",
"registrant_zip": "REDACTED FOR PRIVACY",
"registrant_country": "GB",
"registrant_email": "please query the rdds service of the registrar of record identified in this output for information on how to contact the registrant, admin, or tech contact of the queried domain name.",
"registrant_phone": "REDACTED FOR PRIVACY",
"registrant_fax": "REDACTED FOR PRIVACY",
"name_servers": [
"ns1.domainhotelli.fi",
"ns2.domainhotelli.fi"
],
"domain_status": [
"clientTransferProhibited"
],
"dns_sec": [
"unsigned"
]
},
{
"num": 79,
"domain_name": "innovationhomeworld.com",
"domain_keyword": "innovationhomeworld",
"domain_tld": "com",
"query_time": "2024-03-19 01:18:49",
"create_date": "2020-04-08",
"update_date": "2022-10-10",
"expiry_date": "2025-04-08",
"registrar_iana": 1387,
"registrar_name": "1API GmbH",
"registrar_website": "http://www.1api.net",
"name_servers": [
"ns1.domainhotelli.fi",
"ns2.domainhotelli.fi"
],
"domain_status": [
"clientTransferProhibited"
],
"dns_sec": [
"unsigned"
]
},
{
"num": 80,
"domain_name": "goesbattery.com",
"domain_keyword": "goesbattery",
"domain_tld": "com",
"query_time": "2024-03-19 01:19:22",
"create_date": "2020-04-08",
"update_date": "2023-03-13",
"expiry_date": "2025-04-08",
"registrar_iana": 420,
"registrar_name": "Alibaba Cloud Computing (Beijing) Co., Ltd.",
"registrar_website": "http://www.net.cn",
"registrant_state": "shang hai",
"registrant_country": "CN",
"registrant_email": "https://whois.aliyun.com/whois/whoisform",
"name_servers": [
"ns-1028.awsdns-00.org",
"ns-1969.awsdns-54.co.uk",
"ns-351.awsdns-43.com",
"ns-635.awsdns-15.net"
],
"domain_status": [
"ok"
],
"dns_sec": [
"unsigned"
]
},
{
"num": 81,
"domain_name": "avalon-lab.coop",
"domain_keyword": "avalon-lab",
"domain_tld": "coop",
"query_time": "2024-03-19 01:26:50",
"create_date": "2020-04-08",
"update_date": "2024-03-13",
"expiry_date": "2025-04-08",
"registrar_iana": 81,
"registrar_name": "Gandi SAS",
"registrar_website": "www.gandi.net",
"registrant_name": "REDACTED FOR PRIVACY",
"registrant_company": "Avalon Lab",
"registrant_address": "REDACTED FOR PRIVACY",
"registrant_city": "REDACTED FOR PRIVACY",
"registrant_zip": "REDACTED FOR PRIVACY",
"registrant_country": "FR",
"registrant_email": "please query the rdds service of the registrar of record identified in this output for information on how to contact the registrant, admin, or tech contact of the queried domain name.",
"registrant_phone": "REDACTED FOR PRIVACY",
"registrant_fax": "REDACTED FOR PRIVACY",
"name_servers": [
"ns-107-a.gandi.net",
"ns-37-b.gandi.net",
"ns-40-c.gandi.net"
],
"domain_status": [
"clientTransferProhibited"
],
"dns_sec": [
"unsigned"
]
},
{
"num": 82,
"domain_name": "active-coin.xyz",
"domain_keyword": "active-coin",
"domain_tld": "xyz",
"query_time": "2024-03-19 01:41:53",
"create_date": "2020-04-08",
"update_date": "2024-03-09",
"expiry_date": "2025-04-08",
"registrar_iana": 1449,
"registrar_name": "URL Solutions Inc.",
"registrar_website": "https://pananames.com",
"registrant_company": "GLOBAL DOMAIN PRIVACY SERVICES INC",
"registrant_state": "NA",
"registrant_country": "PA",
"registrant_email": "please query the rdds service of the registrar of record identified in this output for information on how to contact the registrant, admin, or tech contact of the queried domain name.",
"name_servers": [
"pns41.cloudns.net",
"pns42.cloudns.net",
"pns43.cloudns.net",
"pns44.cloudns.net"
],
"domain_status": [
"clientTransferProhibited"
],
"dns_sec": [
"unsigned"
]
},
{
"num": 83,
"domain_name": "active-senior-net.com",
"domain_keyword": "active-senior-net",
"domain_tld": "com",
"query_time": "2024-03-19 01:42:07",
"create_date": "2020-04-08",
"update_date": "2023-11-09",
"expiry_date": "2025-04-08",
"registrar_iana": 1557,
"registrar_name": "Netowl, Inc.",
"registrar_website": "www.star-domain.jp",
"registrant_name": "Xserver Xserver Inc.",
"registrant_company": "Xserver Inc.",
"registrant_address": "GRAND FRONT OSAKA TOWER A 13F, 4-20 Ofukacho, Kita-ku",
"registrant_city": "Osaka",
"registrant_state": "Osaka",
"registrant_zip": "5300011",
"registrant_country": "JP",
"registrant_email": "[email protected]",
"registrant_phone": "+81.662928811",
"name_servers": [
"ns1.xserver.jp",
"ns2.xserver.jp",
"ns3.xserver.jp",
"ns4.xserver.jp",
"ns5.xserver.jp"
],
"domain_status": [
"- https://www.icann.org/epp#"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 84,
"domain_name": "ecic.online",
"domain_keyword": "ecic",
"domain_tld": "online",
"query_time": "2024-03-19 01:45:35",
"create_date": "2020-04-08",
"update_date": "2024-03-08",
"expiry_date": "2025-04-08",
"registrar_iana": 81,
"registrar_name": "Gandi SAS",
"registrar_website": "http://www.gandi.net/",
"registrant_country": "FR",
"registrant_email": "please query the rdds service of the registrar of record identified in this output for information on how to contact the registrant, admin, or tech contact of the queried domain name.",
"name_servers": [
"ldnsie1p.e-i.net",
"ldnsie2p.e-i.net",
"ldnsse1p.e-i.net",
"ldnsse2p.e-i.net"
],
"domain_status": [
"clientTransferProhibited"
],
"dns_sec": [
"unsigned"
]
},
{
"num": 85,
"domain_name": "eco-rns.com",
"domain_keyword": "eco-rns",
"domain_tld": "com",
"query_time": "2024-03-19 01:48:11",
"create_date": "2020-04-08",
"update_date": "2022-10-12",
"expiry_date": "2025-04-08",
"registrar_iana": 244,
"registrar_name": "gabia",
"registrar_website": "https://www.gabia.com",
"registrant_name": "Ryu Kyu Bo",
"registrant_address": "487, Chungnyeol-daero, Dongnae-gu, Busan",
"registrant_city": "Busan",
"registrant_zip": "47798",
"registrant_country": "KR",
"registrant_email": "[email protected]",
"registrant_phone": "+82.515232601",
"name_servers": [
"ns.gabia.co.kr",
"ns.gabia.net",
"ns1.gabia.co.kr"
],
"domain_status": [
"ok"
],
"dns_sec": [
"unsigned"
]
},
{
"num": 86,
"domain_name": "micmacsttropez.net",
"domain_keyword": "micmacsttropez",
"domain_tld": "net",
"query_time": "2024-03-19 02:01:11",
"create_date": "2020-04-08",
"update_date": "2024-03-14",
"expiry_date": "2025-04-08",
"registrar_iana": 81,
"registrar_name": "Gandi SAS",
"registrar_website": "http://www.gandi.net",
"name_servers": [
"ns-1-a.gandi.net",
"ns-123-c.gandi.net",
"ns-87-b.gandi.net"
],
"domain_status": [
"clientTransferProhibited"
],
"dns_sec": [
"unsigned"
]
},
{
"num": 87,
"domain_name": "beltimpex.com",
"domain_keyword": "beltimpex",
"domain_tld": "com",
"query_time": "2024-03-19 02:05:37",
"create_date": "2020-04-08",
"update_date": "2020-07-15",
"expiry_date": "2025-04-07",
"registrar_iana": 463,
"registrar_name": "Regional Network Information Center, JSC dba RU-CENTER",
"registrar_website": "http://www.nic.ru",
"registrant_name": "TPK Beltimpex Ltd",
"registrant_company": "TPK Beltimpex Ltd",
"registrant_address": "Yaroslavskoe shosse, dom 146, korpus 2, etazh 3, pom. 302",
"registrant_city": "Moscow",
"registrant_state": "Moscow",
"registrant_zip": "129347",
"registrant_country": "RU",
"registrant_email": "[email protected]",
"registrant_phone": "+7.4954119146",
"name_servers": [
"ns1.agora.ru",
"ns2.agora.ru"
],
"domain_status": [
"clientTransferProhibited"
],
"dns_sec": [
"unsigned"
]
},
{
"num": 88,
"domain_name": "clairdelunerosporden.com",
"domain_keyword": "clairdelunerosporden",
"domain_tld": "com",
"query_time": "2024-03-19 02:18:17",
"create_date": "2020-04-08",
"update_date": "2024-03-14",
"expiry_date": "2026-04-08",
"registrar_iana": 3817,
"registrar_name": "Wix.com Ltd.",
"registrar_website": "http://www.wix.com",
"name_servers": [
"ns4.wixdns.net",
"ns5.wixdns.net"
],
"domain_status": [
"clientTransferProhibited",
"clientUpdateProhibited"
],
"dns_sec": [
"unsigned"
]
},
{
"num": 89,
"domain_name": "authormx.com",
"domain_keyword": "authormx",
"domain_tld": "com",
"query_time": "2024-03-19 02:20:54",
"create_date": "2020-04-08",
"update_date": "2024-03-15",
"expiry_date": "2025-04-08",
"registrar_iana": 48,
"registrar_name": "ENOM, INC.",
"registrar_website": "WWW.ENOMDOMAINS.COM",
"registrant_name": "REDACTED FOR PRIVACY",
"registrant_company": "REDACTED FOR PRIVACY",
"registrant_address": "REDACTED FOR PRIVACY",
"registrant_city": "REDACTED FOR PRIVACY",
"registrant_state": "MA",
"registrant_zip": "REDACTED FOR PRIVACY",
"registrant_country": "US",
"registrant_email": "https://tieredaccess.com/contact/ad0375ff-31ba-47b3-960d-623179eafe16",
"registrant_phone": "REDACTED FOR PRIVACY",
"registrant_fax": "REDACTED FOR PRIVACY",
"name_servers": [
"lara.ns.cloudflare.com",
"tim.ns.cloudflare.com"
],
"domain_status": [
"clientTransferProhibited",
"renewPeriod"
],
"dns_sec": [
"unsigned"
]
},
{
"num": 90,
"domain_name": "distanciationsociale.ca",
"domain_keyword": "distanciationsociale",
"domain_tld": "ca",
"query_time": "2024-03-19 02:32:26",
"create_date": "2020-04-08",
"update_date": "2024-03-18",
"expiry_date": "2025-04-08",
"registrar_name": "WHC Online Solutions Inc.",
"registrar_website": "https://whc.ca",
"registrant_name": "Junior Tifo Consultant",
"registrant_company": "Junior Tifo Consultant",
"registrant_address": "271 Ste-Marie",
"registrant_city": "St-Boniface",
"registrant_state": "QC",
"registrant_zip": "G0X2L0",
"registrant_country": "CA",
"registrant_email": "[email protected]",
"registrant_phone": "+1.8196681073",
"name_servers": [
"ns1.odedi91204.mywhc.ca",
"ns2.odedi91204.mywhc.ca"
],
"domain_status": [
"clientTransferProhibited"
],
"dns_sec": [
"unsigned"
]
},
{
"num": 91,
"domain_name": "viperbestass.com",
"domain_keyword": "viperbestass",
"domain_tld": "com",
"query_time": "2024-03-19 02:34:39",
"create_date": "2020-04-08",
"update_date": "2023-06-23",
"expiry_date": "2025-04-08",
"registrar_iana": 1910,
"registrar_name": "Cloudflare, Inc.",
"registrar_website": "https://www.cloudflare.com",
"registrant_name": "DATA REDACTED",
"registrant_company": "DATA REDACTED",
"registrant_address": "DATA REDACTED",
"registrant_city": "DATA REDACTED",
"registrant_state": "CA",
"registrant_zip": "DATA REDACTED",
"registrant_country": "US",
"registrant_email": "https://domaincontact.cloudflareregistrar.com/viperbestass.com",
"registrant_phone": "DATA REDACTED",
"registrant_fax": "DATA REDACTED",
"name_servers": [
"lina.ns.cloudflare.com",
"todd.ns.cloudflare.com"
],
"domain_status": [
"clientTransferProhibited"
],
"dns_sec": [
"unsigned"
]
},
{
"num": 92,
"domain_name": "sidehustlesavior.com",
"domain_keyword": "sidehustlesavior",
"domain_tld": "com",
"query_time": "2024-03-19 02:36:03",
"create_date": "2020-04-08",
"update_date": "2024-03-15",
"expiry_date": "2025-04-08",
"registrar_iana": 1068,
"registrar_name": "NAMECHEAP INC",
"registrar_website": "http://www.namecheap.com",
"registrant_name": "Redacted for Privacy",
"registrant_company": "Privacy service provided by Withheld for Privacy ehf",
"registrant_address": "Kalkofnsvegur 2",
"registrant_city": "Reykjavik",
"registrant_state": "Capital Region",
"registrant_zip": "101",
"registrant_country": "IS",
"registrant_email": "[email protected]",
"registrant_phone": "+354.4212434",
"name_servers": [
"ns44.wpxhosting.com",
"ns45.wpxhosting.com"
],
"domain_status": [
"clientTransferProhibited",
"renewPeriod"
],
"dns_sec": [
"unsigned"
]
},
{
"num": 93,
"domain_name": "disus.net",
"domain_keyword": "disus",
"domain_tld": "net",
"query_time": "2024-03-19 02:36:59",
"create_date": "2020-04-08",
"update_date": "2024-03-11",
"expiry_date": "2026-04-08",
"registrar_iana": 1895,
"registrar_name": "Namespro Solutions INC.",
"registrar_website": "http://www.namespro.ca",
"registrant_name": "Namespro.ca PrivateWHOIS",
"registrant_company": "Namespro.ca PrivateWHOIS",
"registrant_address": "PO Box 97083, RICHMOND PO MAIN",
"registrant_city": "Richmond",
"registrant_state": "BC",
"registrant_zip": "V6X8H3",
"registrant_country": "CA",
"registrant_email": "[email protected]",
"registrant_phone": "+1.6046828059",
"name_servers": [
"slns1.namespro.ca",
"slns2.namespro.ca"
],
"domain_status": [
"clientTransferProhibited"
],
"dns_sec": [
"Unsigned"
]
},
{
"num": 94,
"domain_name": "haciendalasadelitas.com",
"domain_keyword": "haciendalasadelitas",
"domain_tld": "com",
"query_time": "2024-03-19 02:42:14",
"create_date": "2020-04-08",
"update_date": "2020-04-08",
"expiry_date": "2025-04-08",
"registrar_iana": 146,
"registrar_name": "GoDaddy.com, LLC",
"registrar_website": "https://www.godaddy.com",
"registrant_name": "Registration Private",
"registrant_company": "Domains By Proxy, LLC",
"registrant_address": "DomainsByProxy.com, 2155 E Warner Rd",
"registrant_city": "Tempe",
"registrant_state": "Arizona",
"registrant_zip": "85284",
"registrant_country": "US",
"registrant_email": "select contact domain holder link at https://www.godaddy.com/whois/results.aspx?domain=haciendalasadelitas.com",
"registrant_phone": "+1.4806242599",
"name_servers": [
"ns45.domaincontrol.com",
"ns46.domaincontrol.com"
],
"domain_status": [
"clientDeleteProhibited",
"clientRenewProhibited",
"clientTransferProhibited",
"clientUpdateProhibited"
],
"dns_sec": [
"unsigned"
]
},
{
"num": 95,
"domain_name": "findmythoughts.com",
"domain_keyword": "findmythoughts",
"domain_tld": "com",
"query_time": "2024-03-19 03:30:50",
"create_date": "2020-04-08",
"update_date": "2024-03-09",
"expiry_date": "2025-04-08",
"registrar_iana": 1531,
"registrar_name": "Automattic Inc.",
"registrar_website": "http://www.automattic.com/",
"registrant_name": "Private Whois",
"registrant_company": "Knock Knock WHOIS Not There, LLC",
"registrant_address": "9450 SW Gemini Dr #63259",
"registrant_city": "Beaverton",
"registrant_zip": "97008-7105",
"registrant_country": "US",
"registrant_email": "[email protected]",
"registrant_phone": "+1.8772738550",
"name_servers": [
"ns1.wordpress.com",
"ns2.wordpress.com",
"ns3.wordpress.com"
],
"domain_status": [
"clientTransferProhibited"
],
"dns_sec": [
"unsigned"
]
},
{
"num": 96,
"domain_name": "findnowi.com",
"domain_keyword": "findnowi",
"domain_tld": "com",
"query_time": "2024-03-19 03:30:56",
"create_date": "2020-04-08",
"update_date": "2023-03-10",
"expiry_date": "2025-04-08",
"registrar_iana": 1068,
"registrar_name": "NAMECHEAP INC",
"registrar_website": "http://www.namecheap.com",
"registrant_name": "Redacted for Privacy",
"registrant_company": "Privacy service provided by Withheld for Privacy ehf",
"registrant_address": "Kalkofnsvegur 2",
"registrant_city": "Reykjavik",
"registrant_state": "Capital Region",
"registrant_zip": "101",
"registrant_country": "IS",
"registrant_email": "[email protected]",
"registrant_phone": "+354.4212434",
"name_servers": [
"dns1.registrar-servers.com",
"dns2.registrar-servers.com"
],
"domain_status": [
"clientTransferProhibited"
],
"dns_sec": [
"unsigned"
]
},
{
"num": 97,
"domain_name": "findwalks.com",
"domain_keyword": "findwalks",
"domain_tld": "com",
"query_time": "2024-03-19 03:32:49",
"create_date": "2020-04-08",
"update_date": "2021-04-02",
"expiry_date": "2025-04-08",
"registrar_iana": 1441,
"registrar_name": "TurnCommerce, Inc. DBA NameBright.com",
"registrar_website": "https://www.NameBright.com",
"registrant_name": "Domain Admin / This Domain is For Sale",
"registrant_company": "HugeDomains.com",
"registrant_address": "2635 Walnut Street",
"registrant_city": "Denver",
"registrant_state": "CO",
"registrant_zip": "80205",
"registrant_country": "US",
"registrant_email": "[email protected]",
"registrant_phone": "+1.3038930552",
"name_servers": [
"nsg1.namebrightdns.com",
"nsg2.namebrightdns.com"
],
"domain_status": [
"clientTransferProhibited"
],
"dns_sec": [
"unsigned"
]
},
{
"num": 98,
"domain_name": "findyourhappinesstest.com",
"domain_keyword": "findyourhappinesstest",
"domain_tld": "com",
"query_time": "2024-03-19 03:33:28",
"create_date": "2020-04-08",
"update_date": "2024-03-05",
"expiry_date": "2025-04-08",
"registrar_iana": 468,
"registrar_name": "Amazon Registrar, Inc.",
"registrar_website": "https://registrar.amazon.com",
"registrant_name": "On behalf of findyourhappinesstest.com owner",
"registrant_company": "Identity Protection Service",
"registrant_address": "PO Box 786",
"registrant_city": "Hayes",
"registrant_state": "Middlesex",
"registrant_zip": "UB3 9TR",
"registrant_country": "GB",
"registrant_email": "[email protected]",
"registrant_phone": "+44.1483307527",
"registrant_fax": "+44.1483304031",
"name_servers": [
"ns-1118.awsdns-11.org",
"ns-1931.awsdns-49.co.uk",
"ns-21.awsdns-02.com",
"ns-837.awsdns-40.net"
],
"domain_status": [
"ok"
],
"dns_sec": [
"unsigned"
]
},
{
"num": 99,
"domain_name": "the-sample-design.com",
"domain_keyword": "the-sample-design",
"domain_tld": "com",
"query_time": "2024-03-19 03:35:18",
"create_date": "2020-04-08",
"update_date": "2024-03-11",
"expiry_date": "2025-04-08",
"registrar_iana": 49,
"registrar_name": "GMO INTERNET, INC.",
"registrar_website": "http://www.onamae.com",
"registrant_name": "Whois Privacy Protection Service by MuuMuuDomain",
"registrant_company": "Whois Privacy Protection Service by MuuMuuDomain",
"registrant_address": "2-7-21 Tenjin Chuo-ku, Tenjin Prime 8F",
"registrant_city": "Fukuoka-shi",
"registrant_state": "Fukuoka",
"registrant_zip": "810-0001",
"registrant_country": "JP",
"registrant_email": "[email protected]",
"registrant_phone": "+81.927137999",
"registrant_fax": "+81.927137944",
"name_servers": [
"dns01.muumuu-domain.com",
"dns02.muumuu-domain.com"
],
"domain_status": [
"clientTransferProhibited"
],
"dns_sec": [
"unsigned"
]
},
{
"num": 100,
"domain_name": "the51x.com",
"domain_keyword": "the51x",
"domain_tld": "com",
"query_time": "2024-03-19 03:37:40",
"create_date": "2020-04-08",
"update_date": "2022-03-25",
"expiry_date": "2025-04-08",
"registrar_iana": 100,
"registrar_name": "Whois Corp.",
"registrar_website": "http://www.whois.co.kr",
"registrant_name": "cho sangeun",
"registrant_company": "cho sangeun",
"registrant_address": "34 Sangamsan-ro Mapo-gu Seoul 18",
"registrant_city": "floor",
"registrant_zip": "03909",
"registrant_country": "KR",
"registrant_email": "[email protected]",
"registrant_phone": "+82.23237331",
"name_servers": [
"ns1.whoisdomain.kr",
"ns2.whoisdomain.kr",
"ns3.whoisdomain.kr",
"ns4.whoisdomain.kr"
],
"domain_status": [
"clientTransferProhibited"
],
"dns_sec": [
"unsigned"
]
}
],
"search_after": "1710819460000_1930128",
"stats": {
"total_time": 0.564,
"api_credits_used": 1,
"cost_calculation": "1 (search_fields[create_date])"
}
}
<root>
<success>true</success>
<query>
<database>current</database>
<create_date>2020-04-08</create_date>
<sort_by>query_time</sort_by>
<sort_order>asc</sort_order>
<page_size>100</page_size>
</query>
<count>
<total>10000</total>
<relation>gte</relation>
<current>100</current>
</count>
<unique_domains>ce.or.kr, onmoving.co.kr, indiehouse.co.kr, mainstreet.co.kr, tiny.my.id, kwskg.or.kr, nuteco.uz, recettesdecuisine.ma, ptgbk.co.id, componentsonly.mn, samehada.my.id, chatoire.re, galmaemot.or.kr, vitamilk.uz, syfens.ma, avsystem.ma, viz.sc, pts.ms, zamowmaterac.pl, wybrednamaruda.pl, sts-tv.pl, koloseo.pl, jaroszmiroslaw.pl, urzeczegassy.pl, fundacjapoz.pl, tomekflorja.pl, przewozyberlinski.pl, sklepklasa.pl, polishpremium.pl, apartamentyrajcza.pl, xn--podruje-o0a74j.pl, kasztanowapark.pl, agnieszkagebusia.pl, wiktorkowalski.pl, notariuszegdynia.pl, brylcar.pl, mwinstal.pl, ekojudecki.pl, nwstal.pl, meblearino.pl, skleppm.pl, symbicortturbuhaler.co.uk, zappatos.uk, car-man.pl, polisa-grupowa.pl, ptsm.com.pl, caigatetex.co.uk, poradnikzwiazkowca.pl, mojelektryk.pl, colorfolk.pl, pracownicyzfilipin.pl, wygodnakanapa.pl, wartkaakcja.pl, polcrane.pl, pomponkomis.pl, galeriakochanestarocie.pl, printtime.co.uk, dekarz-katowice.pl, anticoasianexell.com, whozzbuy.com, ctfireblade.com, komurodesignhouse.com, apmfs.com, tatsu.ninja, i-pinky-swear.com, taxhawk.live, newchungfishchipsandchinesetakeaway.com, ispotdesignexpression.com, newfundingupdate.com, sktmanba.com, dentalfocus.org, astohapico.co.jp, skyfuture.xyz, thinkaheadfinancial.com, esperanzatoros.org, innovationhomegroup.com, innovationhomeshop.com, innovationhome.info, innovationhomeworld.com, goesbattery.com, avalon-lab.coop, active-coin.xyz, active-senior-net.com, ecic.online, eco-rns.com, micmacsttropez.net, beltimpex.com, clairdelunerosporden.com, authormx.com, distanciationsociale.ca, viperbestass.com, sidehustlesavior.com, disus.net, haciendalasadelitas.com, findmythoughts.com, findnowi.com, findwalks.com, findyourhappinesstest.com, the-sample-design.com, the51x.com</unique_domains>
<results>
<value>
<num>1</num>
<domain_name>ce.or.kr</domain_name>
<domain_keyword>ce</domain_keyword>
<domain_tld>or.kr</domain_tld>
<query_time>2021-03-21 07:39:30</query_time>
<create_date>2020-04-08</create_date>
<update_date>2020-04-08</update_date>
<expiry_date>2025-04-08</expiry_date>
<registrar_name>(?)???</registrar_name>
<registrar_website>http://www.gabia.co.kr</registrar_website>
<registrant_name>????? ?????</registrant_name>
<registrant_address>???? ??? ??? ??? 298 ????? (50-208) 298, Daeseong-ro, Cheongwon-gu, Cheongju-si, Chungcheongbuk-do,</registrant_address>
<registrant_zip>28503</registrant_zip>
</value>
<value>
<num>2</num>
<domain_name>onmoving.co.kr</domain_name>
<domain_keyword>onmoving</domain_keyword>
<domain_tld>co.kr</domain_tld>
<query_time>2021-07-07 18:27:37</query_time>
<create_date>2020-04-08</create_date>
<update_date>2021-03-22</update_date>
<expiry_date>2024-04-08</expiry_date>
<registrar_name>(?)???</registrar_name>
<registrar_website>http://www.gabia.co.kr</registrar_website>
<registrant_name>?????</registrant_name>
<registrant_address>????? ??? ???24? 26 B? 821?(???,??????????????????) 26, Beotkkot-ro 24-gil, Geumcheon-gu, Seoul,</registrant_address>
<registrant_zip>08517</registrant_zip>
</value>
<value>
<num>3</num>
<domain_name>indiehouse.co.kr</domain_name>
<domain_keyword>indiehouse</domain_keyword>
<domain_tld>co.kr</domain_tld>
<query_time>2022-01-01 17:19:11</query_time>
<create_date>2020-04-08</create_date>
<update_date>2020-04-08</update_date>
<expiry_date>2025-04-08</expiry_date>
<registrar_name>(?)???</registrar_name>
<registrar_website>http://www.gabia.co.kr</registrar_website>
<registrant_name>??????? ?????</registrant_name>
<registrant_address>??? ??? ??? 2041 ??? 2041, Gyeonggang-ro, Gangneung-si, Gangwon-do,</registrant_address>
<registrant_zip>25534</registrant_zip>
</value>
<value>
<num>4</num>
<domain_name>mainstreet.co.kr</domain_name>
<domain_keyword>mainstreet</domain_keyword>
<domain_tld>co.kr</domain_tld>
<query_time>2022-02-20 18:00:11</query_time>
<create_date>2020-04-08</create_date>
<update_date>2021-03-03</update_date>
<expiry_date>2030-04-08</expiry_date>
<registrar_name>(?)???</registrar_name>
<registrar_website>http://www.gabia.co.kr</registrar_website>
<registrant_name>??? ???</registrant_name>
<registrant_address>??? ??? ??? ????? 660, ?????1 B? 4? , Seongnam-si, Gyeonggi-do U-Space1 Complex B, 4F, 660, Daewangpangyo-ro, Bundang-gu,</registrant_address>
<registrant_zip>13494</registrant_zip>
</value>
<value>
<num>5</num>
<domain_name>tiny.my.id</domain_name>
<domain_keyword>tiny</domain_keyword>
<domain_tld>my.id</domain_tld>
<query_time>2022-04-08 06:21:20</query_time>
<create_date>2020-04-08</create_date>
<update_date>2022-03-30</update_date>
<expiry_date>2024-04-08</expiry_date>
<domain_status>
<value>clientTransferProhibited</value>
</domain_status>
</value>
<value>
<num>6</num>
<domain_name>kwskg.or.kr</domain_name>
<domain_keyword>kwskg</domain_keyword>
<domain_tld>or.kr</domain_tld>
<query_time>2022-05-29 12:52:13</query_time>
<create_date>2020-04-08</create_date>
<update_date>2020-04-08</update_date>
<expiry_date>2025-04-08</expiry_date>
<registrar_name>(?)???</registrar_name>
<registrar_website>http://www.gabia.co.kr</registrar_website>
<registrant_name>??????</registrant_name>
<registrant_address>??? ???? ???32?? 30 ?????? 30, Ipseok-ro 32beon-gil, Uijeongbu-si, Gyeonggi-do,</registrant_address>
<registrant_zip>11601</registrant_zip>
</value>
<value>
<num>7</num>
<domain_name>nuteco.uz</domain_name>
<domain_keyword>nuteco</domain_keyword>
<domain_tld>uz</domain_tld>
<query_time>2022-06-02 08:23:53</query_time>
<create_date>2020-04-08</create_date>
<update_date>2022-03-25</update_date>
<expiry_date>2024-04-08</expiry_date>
<registrar_name>BILLURCOM</registrar_name>
<name_servers>
<value>not.defined</value>
<value>ns.megagroup.ru</value>
<value>ns1.megagroup.ru</value>
<value>ns2.megagroup.ru</value>
</name_servers>
<domain_status>
<value>ACTIVE</value>
</domain_status>
</value>
<value>
<num>8</num>
<domain_name>recettesdecuisine.ma</domain_name>
<domain_keyword>recettesdecuisine</domain_keyword>
<domain_tld>ma</domain_tld>
<query_time>2022-06-02 15:24:47</query_time>
<create_date>2020-04-08</create_date>
<update_date>2022-04-02</update_date>
<expiry_date>2024-04-08</expiry_date>
<registrar_name>MEGALOGI</registrar_name>
<registrant_name>Fatima Zahra LAMOUALDI</registrant_name>
<name_servers>
<value>anuj.ns.cloudflare.com</value>
<value>barbara.ns.cloudflare.com</value>
</name_servers>
<domain_status>
<value>ok</value>
</domain_status>
</value>
<value>
<num>9</num>
<domain_name>ptgbk.co.id</domain_name>
<domain_keyword>ptgbk</domain_keyword>
<domain_tld>co.id</domain_tld>
<query_time>2022-06-03 06:13:42</query_time>
<create_date>2020-04-08</create_date>
<update_date>2022-05-23</update_date>
<expiry_date>2024-04-08</expiry_date>
<domain_status>
<value>clientTransferProhibited</value>
</domain_status>
</value>
<value>
<num>10</num>
<domain_name>componentsonly.mn</domain_name>
<domain_keyword>componentsonly</domain_keyword>
<domain_tld>mn</domain_tld>
<query_time>2022-06-08 19:46:52</query_time>
<create_date>2020-04-08</create_date>
<update_date>2022-03-03</update_date>
<expiry_date>2024-04-08</expiry_date>
<registrar_iana>119</registrar_iana>
<registrar_name>Datacom Co., Ltd.</registrar_name>
<registrar_website>whois.nic.mn</registrar_website>
<registrant_name>Adrian Vinnicombe</registrant_name>
<registrant_company>United Media Works</registrant_company>
<registrant_address>PO Box 2078</registrant_address>
<registrant_city>Milton</registrant_city>
<registrant_state>Queensland</registrant_state>
<registrant_zip>4064</registrant_zip>
<registrant_country>AU</registrant_country>
<registrant_email>[email protected]</registrant_email>
<registrant_phone>+61.737081360</registrant_phone>
<name_servers>
<value>ns1.umw-dns.net</value>
<value>ns2.umw-dns.net</value>
</name_servers>
<domain_status>
<value>clientTransferProhibited</value>
</domain_status>
</value>
<value>
<num>11</num>
<domain_name>samehada.my.id</domain_name>
<domain_keyword>samehada</domain_keyword>
<domain_tld>my.id</domain_tld>
<query_time>2022-06-11 18:58:28</query_time>
<create_date>2020-04-08</create_date>
<update_date>2021-12-12</update_date>
<expiry_date>2025-04-08</expiry_date>
<domain_status>
<value>ok</value>
</domain_status>
</value>
<value>
<num>12</num>
<domain_name>chatoire.re</domain_name>
<domain_keyword>chatoire</domain_keyword>
<domain_tld>re</domain_tld>
<query_time>2022-06-12 03:17:52</query_time>
<create_date>2020-04-08</create_date>
<update_date>2022-05-02</update_date>
<expiry_date>2024-04-08</expiry_date>
<registrar_name>GANDI</registrar_name>
<registrant_name>CENTRE COMMERCIAL DU TAMPON 2</registrant_name>
<registrant_address>CENTRE COMMERCIAL DU TAMPON 2 9 rue D'Italie Zac La Chatoire 97430 Le Tampon</registrant_address>
<registrant_country>FR</registrant_country>
<registrant_email>[email protected]</registrant_email>
<registrant_phone>+262.262579393</registrant_phone>
<name_servers>
<value>ns-214-a.gandi.net</value>
<value>ns-233-c.gandi.net</value>
<value>ns-64-b.gandi.net</value>
</name_servers>
<domain_status>
<value>ACTIVE</value>
</domain_status>
</value>
<value>
<num>13</num>
<domain_name>galmaemot.or.kr</domain_name>
<domain_keyword>galmaemot</domain_keyword>
<domain_tld>or.kr</domain_tld>
<query_time>2022-06-13 15:41:55</query_time>
<create_date>2020-04-08</create_date>
<update_date>2020-04-08</update_date>
<expiry_date>2025-04-08</expiry_date>
<registrar_name>(?)???</registrar_name>
<registrar_website>http://www.gabia.co.kr</registrar_website>
<registrant_name>???????</registrant_name>
<registrant_address>???? ??? ??? ????? 610 ??? ???? ??????? 610 Ocheonhaean-ro Ocheon-myeon Boryeong-si Chungcheongnam-do, .</registrant_address>
<registrant_zip>33406</registrant_zip>
</value>
<value>
<num>14</num>
<domain_name>vitamilk.uz</domain_name>
<domain_keyword>vitamilk</domain_keyword>
<domain_tld>uz</domain_tld>
<query_time>2022-07-02 06:38:44</query_time>
<create_date>2020-04-08</create_date>
<update_date>2021-07-14</update_date>
<expiry_date>2026-04-08</expiry_date>
<registrar_name>BILLURCOM</registrar_name>
<name_servers>
<value>not.defined</value>
<value>ns1.beget.com</value>
<value>ns2.beget.com</value>
</name_servers>
<domain_status>
<value>ACTIVE</value>
</domain_status>
</value>
<value>
<num>15</num>
<domain_name>syfens.ma</domain_name>
<domain_keyword>syfens</domain_keyword>
<domain_tld>ma</domain_tld>
<query_time>2022-07-03 04:52:45</query_time>
<create_date>2020-04-08</create_date>
<update_date>2022-02-11</update_date>
<expiry_date>2024-04-08</expiry_date>
<registrar_name>CREATIVE INTERNET SOLUTIONS</registrar_name>
<registrant_name>Salima Khattabi</registrant_name>
<name_servers>
<value>ns1.stackdns.com</value>
<value>ns10.vala-bleu.ma</value>
<value>ns2.stackdns.com</value>
<value>ns3.stackdns.com</value>
<value>ns4.stackdns.com</value>
</name_servers>
<domain_status>
<value>ok</value>
</domain_status>
</value>
<value>
<num>16</num>
<domain_name>avsystem.ma</domain_name>
<domain_keyword>avsystem</domain_keyword>
<domain_tld>ma</domain_tld>
<query_time>2023-03-05 12:52:32</query_time>
<create_date>2020-04-08</create_date>
<update_date>2023-01-05</update_date>
<expiry_date>2024-04-08</expiry_date>
<registrar_name>CREATIVE INTERNET SOLUTIONS</registrar_name>
<registrant_name>AVSYSTEM</registrant_name>
<name_servers>
<value>ns1.stackdns.com</value>
<value>ns2.stackdns.com</value>
<value>ns3.stackdns.com</value>
<value>ns4.stackdns.com</value>
</name_servers>
<domain_status>
<value>ok</value>
</domain_status>
</value>
<value>
<num>17</num>
<domain_name>viz.sc</domain_name>
<domain_keyword>viz</domain_keyword>
<domain_tld>sc</domain_tld>
<query_time>2023-11-01 00:54:23</query_time>
<create_date>2020-04-08</create_date>
<update_date>2023-03-21</update_date>
<expiry_date>2024-04-08</expiry_date>
<registrar_iana>800171</registrar_iana>
<registrar_name>VCS Pty Ltd</registrar_name>
<registrant_name>REDACTED FOR PRIVACY</registrant_name>
<registrant_address>REDACTED FOR PRIVACY</registrant_address>
<registrant_city>REDACTED FOR PRIVACY</registrant_city>
<registrant_zip>REDACTED FOR PRIVACY</registrant_zip>
<registrant_country>US</registrant_country>
<registrant_email>please query the rdds service of the registrar of record identified in this output for information on how to contact the registrant, admin, or tech contact of the queried domain name.</registrant_email>
<registrant_phone>REDACTED FOR PRIVACY</registrant_phone>
<registrant_fax>REDACTED FOR PRIVACY</registrant_fax>
<name_servers>
<value>ns1.digitalocean.com</value>
<value>ns2.digitalocean.com</value>
<value>ns3.digitalocean.com</value>
</name_servers>
<domain_status>
<value>ok</value>
</domain_status>
<dns_sec>
<value>unsigned</value>
</dns_sec>
</value>
<value>
<num>18</num>
<domain_name>pts.ms</domain_name>
<domain_keyword>pts</domain_keyword>
<domain_tld>ms</domain_tld>
<query_time>2023-12-24 19:04:36</query_time>
<create_date>2020-04-08</create_date>
<update_date>2023-01-10</update_date>
<expiry_date>2026-04-08</expiry_date>
<registrar_name>Key-Systems</registrar_name>
<registrant_name>Redacted | EU Registrar</registrant_name>
<registrant_company>PTS Consulting</registrant_company>
<registrant_address>19-133 14 Taikoowan Road, Tai Koo</registrant_address>
<registrant_city>Quarry Bay</registrant_city>
<registrant_state>HKSAR</registrant_state>
<registrant_zip>0000</registrant_zip>
<registrant_country>HK</registrant_country>
<registrant_email>redacted | eu registrar</registrant_email>
<registrant_phone>Redacted | EU Registrar</registrant_phone>
<name_servers>
<value>ns37.domaincontrol.com</value>
<value>ns38.domaincontrol.com</value>
</name_servers>
<domain_status>
<value>ok</value>
</domain_status>
<dns_sec>
<value>unsigned</value>
</dns_sec>
</value>
<value>
<num>19</num>
<domain_name>zamowmaterac.pl</domain_name>
<domain_keyword>zamowmaterac</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-01-20 19:38:10</query_time>
<create_date>2020-04-08</create_date>
<update_date>2023-09-29</update_date>
<expiry_date>2024-04-08</expiry_date>
<registrar_name>dhosting.pl Sp. z o.o.</registrar_name>
<registrar_website>http://dhosting.pl/kontakt</registrar_website>
<name_servers>
<value>jon.quicns.com</value>
<value>kevin.quicns.com</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>20</num>
<domain_name>wybrednamaruda.pl</domain_name>
<domain_keyword>wybrednamaruda</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-02-07 23:00:11</query_time>
<create_date>2020-04-08</create_date>
<update_date>2023-04-02</update_date>
<expiry_date>2024-04-08</expiry_date>
<registrar_name>OVH SAS</registrar_name>
<registrar_website>https://www.ovhcloud.com</registrar_website>
<name_servers>
<value>dns16.ovh.net</value>
<value>ns16.ovh.net</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>21</num>
<domain_name>sts-tv.pl</domain_name>
<domain_keyword>sts-tv</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-02-15 03:04:16</query_time>
<create_date>2020-04-08</create_date>
<update_date>2023-11-22</update_date>
<expiry_date>2024-04-08</expiry_date>
<registrar_name>Aftermarket.pl Limited</registrar_name>
<registrar_website>http://www.AfterMarket.pl/contact.php</registrar_website>
<name_servers>
<value>ns1.aftermarket.pl</value>
<value>ns2.aftermarket.pl</value>
</name_servers>
<dns_sec>
<value>Signed</value>
</dns_sec>
</value>
<value>
<num>22</num>
<domain_name>koloseo.pl</domain_name>
<domain_keyword>koloseo</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-02-16 06:14:21</query_time>
<create_date>2020-04-08</create_date>
<update_date>2023-04-06</update_date>
<expiry_date>2024-04-08</expiry_date>
<registrar_name>dhosting.pl Sp. z o.o.</registrar_name>
<registrar_website>http://dhosting.pl/kontakt</registrar_website>
<name_servers>
<value>ns1.dhosting.pl</value>
<value>ns2.dhosting.pl</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>23</num>
<domain_name>jaroszmiroslaw.pl</domain_name>
<domain_keyword>jaroszmiroslaw</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-02-16 19:11:23</query_time>
<create_date>2020-04-08</create_date>
<update_date>2023-03-12</update_date>
<expiry_date>2024-04-08</expiry_date>
<registrar_name>OVH SAS</registrar_name>
<registrar_website>https://www.ovhcloud.com</registrar_website>
<name_servers>
<value>dns16.ovh.net</value>
<value>ns16.ovh.net</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>24</num>
<domain_name>urzeczegassy.pl</domain_name>
<domain_keyword>urzeczegassy</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-02-17 15:07:13</query_time>
<create_date>2020-04-08</create_date>
<update_date>2023-04-03</update_date>
<expiry_date>2024-04-08</expiry_date>
<registrar_name>cyber_Folks S.A.</registrar_name>
<name_servers>
<value>ns1.kei.pl</value>
<value>ns2.kei.pl</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>25</num>
<domain_name>fundacjapoz.pl</domain_name>
<domain_keyword>fundacjapoz</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-02-20 15:50:03</query_time>
<create_date>2020-04-08</create_date>
<update_date>2023-04-13</update_date>
<expiry_date>2024-04-08</expiry_date>
<registrar_name>nazwa.pl sp. z o.o.</registrar_name>
<registrar_website>www.nazwa.pl</registrar_website>
<name_servers>
<value>ns1.nazwa.pl</value>
<value>ns2.nazwa.pl</value>
<value>ns3.nazwa.pl</value>
</name_servers>
<dns_sec>
<value>Signed</value>
</dns_sec>
</value>
<value>
<num>26</num>
<domain_name>tomekflorja.pl</domain_name>
<domain_keyword>tomekflorja</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-02-21 08:51:56</query_time>
<create_date>2020-04-08</create_date>
<update_date>2023-04-03</update_date>
<expiry_date>2024-04-08</expiry_date>
<registrar_name>LH.pl Sp. z o.o.</registrar_name>
<registrar_website>https://www.lh.pl/</registrar_website>
<name_servers>
<value>ns.lh.pl</value>
<value>ns2.lighthosting.net</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>27</num>
<domain_name>przewozyberlinski.pl</domain_name>
<domain_keyword>przewozyberlinski</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-01 18:01:49</query_time>
<create_date>2020-04-08</create_date>
<update_date>2022-12-21</update_date>
<expiry_date>2026-04-08</expiry_date>
<registrar_name>Consulting Service Sp. z o.o.</registrar_name>
<name_servers>
<value>ns1.i-host.pl</value>
<value>ns2.i-host.pl</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>28</num>
<domain_name>sklepklasa.pl</domain_name>
<domain_keyword>sklepklasa</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-03 16:16:04</query_time>
<create_date>2020-04-08</create_date>
<update_date>2023-04-09</update_date>
<expiry_date>2024-04-08</expiry_date>
<registrar_name>OVH SAS</registrar_name>
<registrar_website>https://www.ovhcloud.com</registrar_website>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>29</num>
<domain_name>polishpremium.pl</domain_name>
<domain_keyword>polishpremium</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-03 22:11:10</query_time>
<create_date>2020-04-08</create_date>
<update_date>2022-02-16</update_date>
<expiry_date>2025-04-08</expiry_date>
<registrar_name>OVH SAS</registrar_name>
<registrar_website>https://www.ovhcloud.com</registrar_website>
<name_servers>
<value>dns16.ovh.net</value>
<value>ns16.ovh.net</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>30</num>
<domain_name>apartamentyrajcza.pl</domain_name>
<domain_keyword>apartamentyrajcza</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-04 04:42:51</query_time>
<create_date>2020-04-08</create_date>
<update_date>2023-04-08</update_date>
<expiry_date>2024-04-08</expiry_date>
<registrar_name>Smarthost Sp. z o.o.</registrar_name>
<name_servers>
<value>dns.smarthost.pl</value>
<value>dns2.smarthost.pl</value>
<value>dns3.smarthost.pl</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>31</num>
<domain_name>xn--podruje-o0a74j.pl</domain_name>
<domain_keyword>xn--podruje-o0a74j</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-04 18:26:46</query_time>
<create_date>2020-04-08</create_date>
<update_date>2022-10-11</update_date>
<expiry_date>2024-04-08</expiry_date>
<registrar_name>Aftermarket.pl Limited</registrar_name>
<registrar_website>http://www.AfterMarket.pl/contact.php</registrar_website>
<name_servers>
<value>ns1.parkingcrew.net</value>
<value>ns2.parkingcrew.net</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>32</num>
<domain_name>kasztanowapark.pl</domain_name>
<domain_keyword>kasztanowapark</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-05 06:56:12</query_time>
<create_date>2020-04-08</create_date>
<update_date>2023-07-25</update_date>
<expiry_date>2025-04-08</expiry_date>
<registrar_name>OVH SAS</registrar_name>
<registrar_website>https://www.ovhcloud.com</registrar_website>
<name_servers>
<value>dns16.ovh.net</value>
<value>ns16.ovh.net</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>33</num>
<domain_name>agnieszkagebusia.pl</domain_name>
<domain_keyword>agnieszkagebusia</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-06 19:19:08</query_time>
<create_date>2020-04-08</create_date>
<update_date>2023-04-05</update_date>
<expiry_date>2024-04-08</expiry_date>
<registrar_name>LH.pl Sp. z o.o.</registrar_name>
<registrar_website>https://www.lh.pl/</registrar_website>
<name_servers>
<value>ns.lh.pl</value>
<value>ns2.lighthosting.net</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>34</num>
<domain_name>wiktorkowalski.pl</domain_name>
<domain_keyword>wiktorkowalski</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-07 13:03:26</query_time>
<create_date>2020-04-08</create_date>
<update_date>2023-06-09</update_date>
<expiry_date>2025-04-08</expiry_date>
<registrar_name>OVH SAS</registrar_name>
<registrar_website>https://www.ovhcloud.com</registrar_website>
<name_servers>
<value>ns-1527.awsdns-62.org</value>
<value>ns-1576.awsdns-05.co.uk</value>
<value>ns-195.awsdns-24.com</value>
<value>ns-917.awsdns-50.net</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>35</num>
<domain_name>notariuszegdynia.pl</domain_name>
<domain_keyword>notariuszegdynia</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-07 16:23:26</query_time>
<create_date>2020-04-08</create_date>
<update_date>2023-03-21</update_date>
<expiry_date>2024-04-08</expiry_date>
<registrar_name>home.pl S.A.</registrar_name>
<registrar_website>https://home.pl/kontakt</registrar_website>
<name_servers>
<value>dns.home.pl</value>
<value>dns2.home.pl</value>
<value>dns3.home.pl</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>36</num>
<domain_name>brylcar.pl</domain_name>
<domain_keyword>brylcar</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-07 22:09:00</query_time>
<create_date>2020-04-08</create_date>
<update_date>2023-02-24</update_date>
<expiry_date>2026-04-08</expiry_date>
<registrar_name>Consulting Service Sp. z o.o.</registrar_name>
<name_servers>
<value>ns1.i-host.pl</value>
<value>ns2.i-host.pl</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>37</num>
<domain_name>mwinstal.pl</domain_name>
<domain_keyword>mwinstal</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-09 10:32:21</query_time>
<create_date>2020-04-08</create_date>
<update_date>2024-03-06</update_date>
<expiry_date>2029-04-08</expiry_date>
<registrar_name>OVH SAS</registrar_name>
<registrar_website>https://www.ovhcloud.com</registrar_website>
<name_servers>
<value>dns11.ovh.net</value>
<value>ns11.ovh.net</value>
</name_servers>
<dns_sec>
<value>Signed</value>
</dns_sec>
</value>
<value>
<num>38</num>
<domain_name>ekojudecki.pl</domain_name>
<domain_keyword>ekojudecki</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-09 14:11:27</query_time>
<create_date>2020-04-08</create_date>
<update_date>2023-04-04</update_date>
<expiry_date>2024-04-08</expiry_date>
<registrar_name>OVH SAS</registrar_name>
<registrar_website>https://www.ovhcloud.com</registrar_website>
<name_servers>
<value>ns1.seohost.pl</value>
<value>ns2.seohost.pl</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>39</num>
<domain_name>nwstal.pl</domain_name>
<domain_keyword>nwstal</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-09 15:21:21</query_time>
<create_date>2020-04-08</create_date>
<update_date>2023-02-22</update_date>
<expiry_date>2025-04-08</expiry_date>
<registrar_name>home.pl S.A.</registrar_name>
<registrar_website>https://home.pl/kontakt</registrar_website>
<name_servers>
<value>dns.home.pl</value>
<value>dns2.home.pl</value>
<value>dns3.home.pl</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>40</num>
<domain_name>meblearino.pl</domain_name>
<domain_keyword>meblearino</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-09 19:22:14</query_time>
<create_date>2020-04-08</create_date>
<update_date>2023-03-27</update_date>
<expiry_date>2024-04-08</expiry_date>
<registrar_name>AZ.pl Sp. z o.o.</registrar_name>
<name_servers>
<value>ns1.dcsaas.net</value>
<value>ns2.dcsaas.net</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>41</num>
<domain_name>skleppm.pl</domain_name>
<domain_keyword>skleppm</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-10 02:40:46</query_time>
<create_date>2020-04-08</create_date>
<update_date>2023-03-28</update_date>
<expiry_date>2024-04-08</expiry_date>
<registrar_name>cyber_Folks S.A.</registrar_name>
<name_servers>
<value>ns1.dcsaas.net</value>
<value>ns2.dcsaas.net</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>42</num>
<domain_name>symbicortturbuhaler.co.uk</domain_name>
<domain_keyword>symbicortturbuhaler</domain_keyword>
<domain_tld>co.uk</domain_tld>
<query_time>2024-03-10 09:05:39</query_time>
<create_date>2020-04-08</create_date>
<update_date>2024-03-09</update_date>
<expiry_date>2025-04-08</expiry_date>
<registrar_name>Nom-IQ Limited t/a Com Laude [Tag = NOMIQ]</registrar_name>
<registrar_website>https://comlaude.com</registrar_website>
<name_servers>
<value>dns1.comlaude-dns.com</value>
<value>dns2.comlaude-dns.net</value>
<value>dns3.comlaude-dns.co.uk</value>
<value>dns4.comlaude-dns.eu</value>
</name_servers>
<domain_status>
<value>Registered until expiry date.</value>
</domain_status>
</value>
<value>
<num>43</num>
<domain_name>zappatos.uk</domain_name>
<domain_keyword>zappatos</domain_keyword>
<domain_tld>uk</domain_tld>
<query_time>2024-03-11 06:52:20</query_time>
<create_date>2020-04-08</create_date>
<update_date>2024-03-07</update_date>
<expiry_date>2025-04-08</expiry_date>
<registrar_name>MARCARIA.COM International Inc [Tag = MARCARIA-US]</registrar_name>
<registrar_website>https://www.marcaria.com/uk</registrar_website>
<name_servers>
<value>lewis.ns.cloudflare.com</value>
<value>raquel.ns.cloudflare.com</value>
</name_servers>
<domain_status>
<value>Registered until expiry date.</value>
</domain_status>
</value>
<value>
<num>44</num>
<domain_name>car-man.pl</domain_name>
<domain_keyword>car-man</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-11 21:50:17</query_time>
<create_date>2020-04-08</create_date>
<update_date>2022-10-25</update_date>
<expiry_date>2025-04-08</expiry_date>
<registrar_name>Consulting Service Sp. z o.o.</registrar_name>
<name_servers>
<value>ns1.i-host.pl</value>
<value>ns2.i-host.pl</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>45</num>
<domain_name>polisa-grupowa.pl</domain_name>
<domain_keyword>polisa-grupowa</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-12 21:02:12</query_time>
<create_date>2020-04-08</create_date>
<update_date>2023-04-03</update_date>
<expiry_date>2024-04-08</expiry_date>
<registrar_name>nazwa.pl sp. z o.o.</registrar_name>
<registrar_website>www.nazwa.pl</registrar_website>
<name_servers>
<value>ns1.nazwa.pl</value>
<value>ns2.nazwa.pl</value>
<value>ns3.nazwa.pl</value>
</name_servers>
<dns_sec>
<value>Signed</value>
</dns_sec>
</value>
<value>
<num>46</num>
<domain_name>ptsm.com.pl</domain_name>
<domain_keyword>ptsm</domain_keyword>
<domain_tld>com.pl</domain_tld>
<query_time>2024-03-13 03:00:36</query_time>
<create_date>2020-04-08</create_date>
<update_date>2023-04-05</update_date>
<expiry_date>2024-04-08</expiry_date>
<registrar_name>nazwa.pl sp. z o.o.</registrar_name>
<registrar_website>www.nazwa.pl</registrar_website>
<name_servers>
<value>eucalyptus.am.poznan.pl</value>
<value>sequoia.am.poznan.pl</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>47</num>
<domain_name>caigatetex.co.uk</domain_name>
<domain_keyword>caigatetex</domain_keyword>
<domain_tld>co.uk</domain_tld>
<query_time>2024-03-13 09:22:02</query_time>
<create_date>2020-04-08</create_date>
<update_date>2023-12-20</update_date>
<expiry_date>2025-04-08</expiry_date>
<registrar_name>123-Reg Limited t/a 123-reg [Tag = 123-REG]</registrar_name>
<registrar_website>https://www.123-reg.co.uk</registrar_website>
<name_servers>
<value>ns3.codetrix.co.uk</value>
<value>ns4.codetrix.co.uk</value>
</name_servers>
<domain_status>
<value>Registered until expiry date.</value>
</domain_status>
</value>
<value>
<num>48</num>
<domain_name>poradnikzwiazkowca.pl</domain_name>
<domain_keyword>poradnikzwiazkowca</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-13 17:28:38</query_time>
<create_date>2020-04-08</create_date>
<update_date>2023-03-21</update_date>
<expiry_date>2024-04-08</expiry_date>
<registrar_name>LH.pl Sp. z o.o.</registrar_name>
<registrar_website>https://www.lh.pl/</registrar_website>
<name_servers>
<value>ns.lh.pl</value>
<value>ns2.lighthosting.net</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>49</num>
<domain_name>mojelektryk.pl</domain_name>
<domain_keyword>mojelektryk</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-14 08:01:17</query_time>
<create_date>2020-04-08</create_date>
<update_date>2023-04-06</update_date>
<expiry_date>2024-04-08</expiry_date>
<registrar_name>cyber_Folks S.A.</registrar_name>
<name_servers>
<value>ns1.premium.pl</value>
<value>ns2.premium.pl</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>50</num>
<domain_name>colorfolk.pl</domain_name>
<domain_keyword>colorfolk</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-14 22:12:26</query_time>
<create_date>2020-04-08</create_date>
<update_date>2023-10-25</update_date>
<expiry_date>2024-04-08</expiry_date>
<registrar_name>home.pl S.A.</registrar_name>
<registrar_website>https://home.pl/kontakt</registrar_website>
<name_servers>
<value>ns1.iq.pl</value>
<value>ns2.iq.pl</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>51</num>
<domain_name>pracownicyzfilipin.pl</domain_name>
<domain_keyword>pracownicyzfilipin</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-15 19:11:35</query_time>
<create_date>2020-04-08</create_date>
<update_date>2023-04-05</update_date>
<expiry_date>2024-04-08</expiry_date>
<registrar_name>PERSKIMEDIA Szymon Perski</registrar_name>
<name_servers>
<value>dns1.microhost.pl</value>
<value>dns2.microhost.pl</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>52</num>
<domain_name>wygodnakanapa.pl</domain_name>
<domain_keyword>wygodnakanapa</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-16 00:15:41</query_time>
<create_date>2020-04-08</create_date>
<update_date>2023-04-12</update_date>
<expiry_date>2024-04-08</expiry_date>
<registrar_name>OVH SAS</registrar_name>
<registrar_website>https://www.ovhcloud.com</registrar_website>
<name_servers>
<value>dns16.ovh.net</value>
<value>ns16.ovh.net</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>53</num>
<domain_name>wartkaakcja.pl</domain_name>
<domain_keyword>wartkaakcja</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-16 00:58:07</query_time>
<create_date>2020-04-08</create_date>
<update_date>2023-03-17</update_date>
<expiry_date>2024-04-08</expiry_date>
<registrar_name>LH.pl Sp. z o.o.</registrar_name>
<registrar_website>https://www.lh.pl/</registrar_website>
<name_servers>
<value>ns.lh.pl</value>
<value>ns2.lighthosting.net</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>54</num>
<domain_name>polcrane.pl</domain_name>
<domain_keyword>polcrane</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-16 05:25:11</query_time>
<create_date>2020-04-08</create_date>
<update_date>2024-03-10</update_date>
<expiry_date>2024-04-08</expiry_date>
<registrar_name>Consulting Service Sp. z o.o.</registrar_name>
<name_servers>
<value>ns1.tittle.pl</value>
<value>ns2.tittle.pl</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>55</num>
<domain_name>pomponkomis.pl</domain_name>
<domain_keyword>pomponkomis</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-16 05:29:06</query_time>
<create_date>2020-04-08</create_date>
<update_date>2023-03-29</update_date>
<expiry_date>2024-04-08</expiry_date>
<registrar_name>AZ.pl Sp. z o.o.</registrar_name>
<name_servers>
<value>ns1.dcsaas.net</value>
<value>ns2.dcsaas.net</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>56</num>
<domain_name>galeriakochanestarocie.pl</domain_name>
<domain_keyword>galeriakochanestarocie</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-16 19:11:19</query_time>
<create_date>2020-04-08</create_date>
<update_date>2023-04-05</update_date>
<expiry_date>2024-04-08</expiry_date>
<registrar_name>home.pl S.A.</registrar_name>
<registrar_website>https://home.pl/kontakt</registrar_website>
<name_servers>
<value>dns.home.pl</value>
<value>dns2.home.pl</value>
<value>dns3.home.pl</value>
</name_servers>
<dns_sec>
<value>Signed</value>
</dns_sec>
</value>
<value>
<num>57</num>
<domain_name>printtime.co.uk</domain_name>
<domain_keyword>printtime</domain_keyword>
<domain_tld>co.uk</domain_tld>
<query_time>2024-03-17 07:02:10</query_time>
<create_date>2020-04-08</create_date>
<update_date>2023-06-09</update_date>
<expiry_date>2024-04-08</expiry_date>
<registrar_name>Garth Piesse [Tag = COHERENT-NZ]</registrar_name>
<name_servers>
<value>ns1.eftydns.com</value>
<value>ns2.eftydns.com</value>
</name_servers>
<domain_status>
<value>Registered until expiry date.</value>
</domain_status>
</value>
<value>
<num>58</num>
<domain_name>dekarz-katowice.pl</domain_name>
<domain_keyword>dekarz-katowice</domain_keyword>
<domain_tld>pl</domain_tld>
<query_time>2024-03-17 23:20:01</query_time>
<create_date>2020-04-08</create_date>
<update_date>2023-01-17</update_date>
<expiry_date>2026-04-08</expiry_date>
<registrar_name>Consulting Service Sp. z o.o.</registrar_name>
<name_servers>
<value>ns1.i-host.pl</value>
<value>ns2.i-host.pl</value>
</name_servers>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>59</num>
<domain_name>anticoasianexell.com</domain_name>
<domain_keyword>anticoasianexell</domain_keyword>
<domain_tld>com</domain_tld>
<query_time>2024-03-19 00:01:14</query_time>
<create_date>2020-04-08</create_date>
<update_date>2023-03-27</update_date>
<expiry_date>2026-04-08</expiry_date>
<registrar_iana>100</registrar_iana>
<registrar_name>Whois Corp.</registrar_name>
<registrar_website>http://www.whois.co.kr</registrar_website>
<registrant_name>CoAsia Corporation</registrant_name>
<registrant_company>CoAsia Corporation</registrant_company>
<registrant_address>67 Jeongui-ro Songpa-gu Seoul Korea</registrant_address>
<registrant_city>7F</registrant_city>
<registrant_zip>05835</registrant_zip>
<registrant_country>KR</registrant_country>
<registrant_email>[email protected]</registrant_email>
<registrant_phone>+82.3151708114</registrant_phone>
<name_servers>
<value>ns1.whoisdomain.kr</value>
<value>ns2.whoisdomain.kr</value>
<value>ns3.whoisdomain.kr</value>
<value>ns4.whoisdomain.kr</value>
</name_servers>
<domain_status>
<value>clientTransferProhibited</value>
</domain_status>
<dns_sec>
<value>unsigned</value>
</dns_sec>
</value>
<value>
<num>60</num>
<domain_name>whozzbuy.com</domain_name>
<domain_keyword>whozzbuy</domain_keyword>
<domain_tld>com</domain_tld>
<query_time>2024-03-19 00:06:51</query_time>
<create_date>2020-04-08</create_date>
<update_date>2024-03-05</update_date>
<expiry_date>2025-04-08</expiry_date>
<registrar_iana>1479</registrar_iana>
<registrar_name>NameSilo, LLC</registrar_name>
<registrar_website>https://www.namesilo.com/</registrar_website>
<registrant_name>REDACTED FOR PRIVACY</registrant_name>
<registrant_company>See PrivacyGuardian.org</registrant_company>
<registrant_address>1928 E. Highland Ave. Ste F104 PMB# 255</registrant_address>
<registrant_city>Phoenix</registrant_city>
<registrant_state>AZ</registrant_state>
<registrant_zip>85016</registrant_zip>
<registrant_country>US</registrant_country>
<registrant_email>[email protected]</registrant_email>
<registrant_phone>+1.3478717726</registrant_phone>
<name_servers>
<value>ns1.cannki.com</value>
<value>ns2.cannki.com</value>
</name_servers>
<domain_status>
<value>clientTransferProhibited</value>
</domain_status>
<dns_sec>
<value>unsigned</value>
</dns_sec>
</value>
<value>
<num>61</num>
<domain_name>ctfireblade.com</domain_name>
<domain_keyword>ctfireblade</domain_keyword>
<domain_tld>com</domain_tld>
<query_time>2024-03-19 00:07:11</query_time>
<create_date>2020-04-08</create_date>
<update_date>2024-02-28</update_date>
<expiry_date>2025-04-08</expiry_date>
<registrar_iana>303</registrar_iana>
<registrar_name>PDR Ltd. d/b/a PublicDomainRegistry.com</registrar_name>
<registrar_website>www.publicdomainregistry.com</registrar_website>
<registrant_name>Domain Admin</registrant_name>
<registrant_company>Privacy Protect, LLC (PrivacyProtect.org)</registrant_company>
<registrant_address>10 Corporate Drive</registrant_address>
<registrant_city>Burlington</registrant_city>
<registrant_state>MA</registrant_state>
<registrant_zip>01803</registrant_zip>
<registrant_country>US</registrant_country>
<registrant_email>[email protected]</registrant_email>
<registrant_phone>+1.8022274003</registrant_phone>
<name_servers>
<value>ns1.reservado.hostgator.com.br</value>
<value>ns2.reservado.hostgator.com.br</value>
</name_servers>
<domain_status>
<value>clientTransferProhibited</value>
</domain_status>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>62</num>
<domain_name>komurodesignhouse.com</domain_name>
<domain_keyword>komurodesignhouse</domain_keyword>
<domain_tld>com</domain_tld>
<query_time>2024-03-19 00:19:26</query_time>
<create_date>2020-04-08</create_date>
<update_date>2024-03-08</update_date>
<expiry_date>2025-04-08</expiry_date>
<registrar_iana>431</registrar_iana>
<registrar_name>DREAMHOST</registrar_name>
<registrar_website>WWW.DREAMHOST.COM</registrar_website>
<registrant_name>Proxy Protection LLC</registrant_name>
<registrant_company>Proxy Protection LLC</registrant_company>
<registrant_address>417 Associated Rd #327, C/O komurodesignhouse.com</registrant_address>
<registrant_city>Brea</registrant_city>
<registrant_state>CA</registrant_state>
<registrant_zip>92821</registrant_zip>
<registrant_country>US</registrant_country>
<registrant_email>[email protected]</registrant_email>
<registrant_phone>+1.7147064182</registrant_phone>
<name_servers>
<value>ns1.dreamhost.com</value>
<value>ns2.dreamhost.com</value>
<value>ns3.dreamhost.com</value>
</name_servers>
<domain_status>
<value>clientTransferProhibited</value>
</domain_status>
<dns_sec>
<value>unsigned</value>
</dns_sec>
</value>
<value>
<num>63</num>
<domain_name>apmfs.com</domain_name>
<domain_keyword>apmfs</domain_keyword>
<domain_tld>com</domain_tld>
<query_time>2024-03-19 00:25:35</query_time>
<create_date>2020-04-08</create_date>
<update_date>2021-04-02</update_date>
<expiry_date>2025-04-08</expiry_date>
<registrar_iana>1441</registrar_iana>
<registrar_name>TurnCommerce, Inc. DBA NameBright.com</registrar_name>
<registrar_website>https://www.NameBright.com</registrar_website>
<registrant_name>Domain Admin / This Domain is For Sale</registrant_name>
<registrant_company>HugeDomains.com</registrant_company>
<registrant_address>2635 Walnut Street</registrant_address>
<registrant_city>Denver</registrant_city>
<registrant_state>CO</registrant_state>
<registrant_zip>80205</registrant_zip>
<registrant_country>US</registrant_country>
<registrant_email>[email protected]</registrant_email>
<registrant_phone>+1.3038930552</registrant_phone>
<name_servers>
<value>nsg1.namebrightdns.com</value>
<value>nsg2.namebrightdns.com</value>
</name_servers>
<domain_status>
<value>clientTransferProhibited</value>
</domain_status>
<dns_sec>
<value>unsigned</value>
</dns_sec>
</value>
<value>
<num>64</num>
<domain_name>tatsu.ninja</domain_name>
<domain_keyword>tatsu</domain_keyword>
<domain_tld>ninja</domain_tld>
<query_time>2024-03-19 00:28:16</query_time>
<create_date>2020-04-08</create_date>
<update_date>2023-07-16</update_date>
<expiry_date>2025-04-08</expiry_date>
<registrar_iana>146</registrar_iana>
<registrar_name>GoDaddy.com, LLC</registrar_name>
<registrar_website>http://www.godaddy.com/domains/search.aspx?ci=8990</registrar_website>
<registrant_name>REDACTED FOR PRIVACY</registrant_name>
<registrant_company>Domains By Proxy, LLC</registrant_company>
<registrant_address>REDACTED FOR PRIVACY</registrant_address>
<registrant_city>REDACTED FOR PRIVACY</registrant_city>
<registrant_state>Arizona</registrant_state>
<registrant_zip>REDACTED FOR PRIVACY</registrant_zip>
<registrant_country>US</registrant_country>
<registrant_email>please query the rdds service of the registrar of record identified in this output for information on how to contact the registrant, admin, or tech contact of the queried domain name.</registrant_email>
<registrant_phone>REDACTED FOR PRIVACY</registrant_phone>
<registrant_fax>REDACTED FOR PRIVACY</registrant_fax>
<name_servers>
<value>ns39.domaincontrol.com</value>
<value>ns40.domaincontrol.com</value>
</name_servers>
<domain_status>
<value>clientDeleteProhibited</value>
<value>clientRenewProhibited</value>
<value>clientTransferProhibited</value>
<value>clientUpdateProhibited</value>
</domain_status>
<dns_sec>
<value>unsigned</value>
</dns_sec>
</value>
<value>
<num>65</num>
<domain_name>i-pinky-swear.com</domain_name>
<domain_keyword>i-pinky-swear</domain_keyword>
<domain_tld>com</domain_tld>
<query_time>2024-03-19 00:30:24</query_time>
<create_date>2020-04-08</create_date>
<update_date>2024-02-19</update_date>
<expiry_date>2025-04-08</expiry_date>
<registrar_iana>1647</registrar_iana>
<registrar_name>Hosting Concepts B.V. d/b/a Registrar.eu</registrar_name>
<registrar_website>https://www.registrar.eu</registrar_website>
<registrant_name>REDACTED FOR PRIVACY</registrant_name>
<registrant_company>Parsley Studio's CC</registrant_company>
<registrant_address>REDACTED FOR PRIVACY</registrant_address>
<registrant_city>REDACTED FOR PRIVACY</registrant_city>
<registrant_state>Gauteng</registrant_state>
<registrant_zip>REDACTED FOR PRIVACY</registrant_zip>
<registrant_country>ZA</registrant_country>
<registrant_email>https://contact-form.registrar.eu/?domainname=i-pinky-swear.com&purpose=owner</registrant_email>
<registrant_phone>REDACTED FOR PRIVACY</registrant_phone>
<registrant_fax>REDACTED FOR PRIVACY</registrant_fax>
<name_servers>
<value>vpsns1.cpt.wa.co.za</value>
<value>vpsns2.cpt.wa.co.za</value>
</name_servers>
<domain_status>
<value>clientTransferProhibited</value>
<value>ok</value>
</domain_status>
<dns_sec>
<value>unsigned</value>
</dns_sec>
</value>
<value>
<num>66</num>
<domain_name>taxhawk.live</domain_name>
<domain_keyword>taxhawk</domain_keyword>
<domain_tld>live</domain_tld>
<query_time>2024-03-19 00:34:27</query_time>
<create_date>2020-04-08</create_date>
<update_date>2024-02-13</update_date>
<expiry_date>2025-04-08</expiry_date>
<registrar_iana>2</registrar_iana>
<registrar_name>Network Solutions, LLC</registrar_name>
<registrar_website>http://www.networksolutions.com</registrar_website>
<registrant_name>REDACTED FOR PRIVACY</registrant_name>
<registrant_company>TaxHawk, Inc</registrant_company>
<registrant_address>REDACTED FOR PRIVACY</registrant_address>
<registrant_city>REDACTED FOR PRIVACY</registrant_city>
<registrant_state>UT</registrant_state>
<registrant_zip>REDACTED FOR PRIVACY</registrant_zip>
<registrant_country>US</registrant_country>
<registrant_email>please query the rdds service of the registrar of record identified in this output for information on how to contact the registrant, admin, or tech contact of the queried domain name.</registrant_email>
<registrant_phone>REDACTED FOR PRIVACY</registrant_phone>
<registrant_fax>REDACTED FOR PRIVACY</registrant_fax>
<name_servers>
<value>eve.ns.cloudflare.com</value>
<value>yahir.ns.cloudflare.com</value>
</name_servers>
<domain_status>
<value>clientTransferProhibited</value>
</domain_status>
<dns_sec>
<value>unsigned</value>
</dns_sec>
</value>
<value>
<num>67</num>
<domain_name>newchungfishchipsandchinesetakeaway.com</domain_name>
<domain_keyword>newchungfishchipsandchinesetakeaway</domain_keyword>
<domain_tld>com</domain_tld>
<query_time>2024-03-19 00:37:24</query_time>
<create_date>2020-04-08</create_date>
<update_date>2024-03-13</update_date>
<expiry_date>2025-04-08</expiry_date>
<registrar_iana>1910</registrar_iana>
<registrar_name>Cloudflare, Inc.</registrar_name>
<registrar_website>https://www.cloudflare.com</registrar_website>
<registrant_name>DATA REDACTED</registrant_name>
<registrant_company>DATA REDACTED</registrant_company>
<registrant_address>DATA REDACTED</registrant_address>
<registrant_city>DATA REDACTED</registrant_city>
<registrant_state>staffordshire</registrant_state>
<registrant_zip>DATA REDACTED</registrant_zip>
<registrant_country>GB</registrant_country>
<registrant_email>https://domaincontact.cloudflareregistrar.com/newchungfishchipsandchinesetakeaway.com</registrant_email>
<registrant_phone>DATA REDACTED</registrant_phone>
<registrant_fax>DATA REDACTED</registrant_fax>
<name_servers>
<value>chan.ns.cloudflare.com</value>
<value>merlin.ns.cloudflare.com</value>
</name_servers>
<domain_status>
<value>clientTransferProhibited</value>
<value>renewPeriod</value>
</domain_status>
<dns_sec>
<value>unsigned</value>
</dns_sec>
</value>
<value>
<num>68</num>
<domain_name>ispotdesignexpression.com</domain_name>
<domain_keyword>ispotdesignexpression</domain_keyword>
<domain_tld>com</domain_tld>
<query_time>2024-03-19 00:38:55</query_time>
<create_date>2020-04-08</create_date>
<update_date>2024-03-10</update_date>
<expiry_date>2025-04-08</expiry_date>
<registrar_iana>48</registrar_iana>
<registrar_name>ENOM, INC.</registrar_name>
<registrar_website>WWW.ENOMDOMAINS.COM</registrar_website>
<registrant_name>REDACTED FOR PRIVACY</registrant_name>
<registrant_company>REDACTED FOR PRIVACY</registrant_company>
<registrant_address>REDACTED FOR PRIVACY</registrant_address>
<registrant_city>REDACTED FOR PRIVACY</registrant_city>
<registrant_state>WA</registrant_state>
<registrant_zip>REDACTED FOR PRIVACY</registrant_zip>
<registrant_country>US</registrant_country>
<registrant_email>https://tieredaccess.com/contact/9046a961-d151-48eb-9a01-c80233ee8f3a</registrant_email>
<registrant_phone>REDACTED FOR PRIVACY</registrant_phone>
<registrant_fax>REDACTED FOR PRIVACY</registrant_fax>
<name_servers>
<value>ns-1103.awsdns-09.org</value>
<value>ns-1677.awsdns-17.co.uk</value>
<value>ns-379.awsdns-47.com</value>
<value>ns-750.awsdns-29.net</value>
</name_servers>
<domain_status>
<value>clientTransferProhibited</value>
</domain_status>
<dns_sec>
<value>unsigned</value>
</dns_sec>
</value>
<value>
<num>69</num>
<domain_name>newfundingupdate.com</domain_name>
<domain_keyword>newfundingupdate</domain_keyword>
<domain_tld>com</domain_tld>
<query_time>2024-03-19 00:39:04</query_time>
<create_date>2020-04-08</create_date>
<update_date>2024-03-05</update_date>
<expiry_date>2025-04-08</expiry_date>
<registrar_iana>468</registrar_iana>
<registrar_name>Amazon Registrar, Inc.</registrar_name>
<registrar_website>https://registrar.amazon.com</registrar_website>
<registrant_name>On behalf of newfundingupdate.com owner</registrant_name>
<registrant_company>Identity Protection Service</registrant_company>
<registrant_address>PO Box 786</registrant_address>
<registrant_city>Hayes</registrant_city>
<registrant_state>Middlesex</registrant_state>
<registrant_zip>UB3 9TR</registrant_zip>
<registrant_country>GB</registrant_country>
<registrant_email>[email protected]</registrant_email>
<registrant_phone>+44.1483307527</registrant_phone>
<registrant_fax>+44.1483304031</registrant_fax>
<name_servers>
<value>ns-1050.awsdns-03.org</value>
<value>ns-1989.awsdns-56.co.uk</value>
<value>ns-84.awsdns-10.com</value>
<value>ns-900.awsdns-48.net</value>
</name_servers>
<domain_status>
<value>ok</value>
</domain_status>
<dns_sec>
<value>unsigned</value>
</dns_sec>
</value>
<value>
<num>70</num>
<domain_name>sktmanba.com</domain_name>
<domain_keyword>sktmanba</domain_keyword>
<domain_tld>com</domain_tld>
<query_time>2024-03-19 00:48:42</query_time>
<create_date>2020-04-08</create_date>
<update_date>2023-04-08</update_date>
<expiry_date>2028-04-08</expiry_date>
<registrar_iana>113</registrar_iana>
<registrar_name>CSL Computer Service Langenbach GmbH d/b/a joker.com</registrar_name>
<registrar_website>https://joker.com</registrar_website>
<registrant_country>GB</registrant_country>
<registrant_email>https://csl-registrar.com/contact/sktmanba.com/owner</registrant_email>
<name_servers>
<value>wp47.mizbanwp.com</value>
<value>wp48.mizbanwp.com</value>
</name_servers>
<domain_status>
<value>clientTransferProhibited</value>
</domain_status>
<dns_sec>
<value>unsigned</value>
</dns_sec>
</value>
<value>
<num>71</num>
<domain_name>dentalfocus.org</domain_name>
<domain_keyword>dentalfocus</domain_keyword>
<domain_tld>org</domain_tld>
<query_time>2024-03-19 00:49:13</query_time>
<create_date>2020-04-08</create_date>
<update_date>2024-03-14</update_date>
<expiry_date>2025-04-08</expiry_date>
<registrar_iana>69</registrar_iana>
<registrar_name>Tucows Domains Inc.</registrar_name>
<registrar_website>http://www.tucows.com</registrar_website>
<registrant_name>REDACTED FOR PRIVACY</registrant_name>
<registrant_company>Sucofocus Ltd</registrant_company>
<registrant_address>REDACTED FOR PRIVACY</registrant_address>
<registrant_city>REDACTED FOR PRIVACY</registrant_city>
<registrant_state>Surrey</registrant_state>
<registrant_zip>REDACTED FOR PRIVACY</registrant_zip>
<registrant_country>GB</registrant_country>
<registrant_email>please query the rdds service of the registrar of record identified in this output for information on how to contact the registrant, admin, or tech contact of the queried domain name.</registrant_email>
<registrant_phone>REDACTED FOR PRIVACY</registrant_phone>
<registrant_fax>REDACTED FOR PRIVACY</registrant_fax>
<name_servers>
<value>ns1.livedns.co.uk</value>
<value>ns2.livedns.co.uk</value>
<value>ns3.livedns.co.uk</value>
</name_servers>
<domain_status>
<value>clientTransferProhibited</value>
<value>clientUpdateProhibited</value>
</domain_status>
<dns_sec>
<value>unsigned</value>
</dns_sec>
</value>
<value>
<num>72</num>
<domain_name>astohapico.co.jp</domain_name>
<domain_keyword>astohapico</domain_keyword>
<domain_tld>co.jp</domain_tld>
<query_time>2024-03-19 00:50:36</query_time>
<create_date>2020-04-08</create_date>
<update_date>2023-05-01</update_date>
<registrant_company>TOPBROSSAN CO.,LTD</registrant_company>
<name_servers>
<value>ns1.value-domain.com</value>
<value>ns2.value-domain.com</value>
</name_servers>
</value>
<value>
<num>73</num>
<domain_name>skyfuture.xyz</domain_name>
<domain_keyword>skyfuture</domain_keyword>
<domain_tld>xyz</domain_tld>
<query_time>2024-03-19 00:50:46</query_time>
<create_date>2020-04-08</create_date>
<update_date>2023-08-31</update_date>
<expiry_date>2025-04-08</expiry_date>
<registrar_iana>1599</registrar_iana>
<registrar_name>Alibaba Cloud Computing Ltd. d/b/a HiChina (www.net.cn)</registrar_name>
<registrant_company>Shenzhen Skyfuture Film Profuction Co.,Ltd</registrant_company>
<registrant_state>guang dong</registrant_state>
<registrant_country>CN</registrant_country>
<registrant_email>please query the rdds service of the registrar of record identified in this output for information on how to contact the registrant, admin, or tech contact of the queried domain name.</registrant_email>
<name_servers>
<value>dns31.hichina.com</value>
<value>dns32.hichina.com</value>
</name_servers>
<domain_status>
<value>ok</value>
</domain_status>
<dns_sec>
<value>unsigned</value>
</dns_sec>
</value>
<value>
<num>74</num>
<domain_name>thinkaheadfinancial.com</domain_name>
<domain_keyword>thinkaheadfinancial</domain_keyword>
<domain_tld>com</domain_tld>
<query_time>2024-03-19 00:54:15</query_time>
<create_date>2020-04-08</create_date>
<update_date>2024-03-13</update_date>
<expiry_date>2029-04-08</expiry_date>
<registrar_iana>1375</registrar_iana>
<registrar_name>Register.ca Inc</registrar_name>
<registrar_website>http://register.ca</registrar_website>
<registrant_name>Privacy Officer</registrant_name>
<registrant_company>SafeWhois.ca Whois Privacy Service</registrant_company>
<registrant_address>5863 Leslie St. Suite 307</registrant_address>
<registrant_city>Toronto</registrant_city>
<registrant_state>Ontario</registrant_state>
<registrant_zip>M2H1J8</registrant_zip>
<registrant_country>CA</registrant_country>
<registrant_email>[email protected]</registrant_email>
<registrant_phone>+1.4163857765</registrant_phone>
<name_servers>
<value>dns1.name-services.com</value>
<value>dns2.name-services.com</value>
<value>dns3.name-services.com</value>
<value>dns4.name-services.com</value>
<value>dns5.name-services.com</value>
</name_servers>
<domain_status>
<value>clientTransferProhibited</value>
<value>clientUpdateProhibited</value>
</domain_status>
<dns_sec>
<value>unsigned</value>
</dns_sec>
</value>
<value>
<num>75</num>
<domain_name>esperanzatoros.org</domain_name>
<domain_keyword>esperanzatoros</domain_keyword>
<domain_tld>org</domain_tld>
<query_time>2024-03-19 01:14:07</query_time>
<create_date>2020-04-08</create_date>
<update_date>2024-03-10</update_date>
<expiry_date>2025-04-08</expiry_date>
<registrar_iana>468</registrar_iana>
<registrar_name>Amazon Registrar, Inc.</registrar_name>
<registrar_website>http://registrar.amazon.com</registrar_website>
<registrant_name>REDACTED FOR PRIVACY</registrant_name>
<registrant_company>Identity Protection Service</registrant_company>
<registrant_address>REDACTED FOR PRIVACY</registrant_address>
<registrant_city>REDACTED FOR PRIVACY</registrant_city>
<registrant_state>Middlesex</registrant_state>
<registrant_zip>REDACTED FOR PRIVACY</registrant_zip>
<registrant_country>GB</registrant_country>
<registrant_email>please query the rdds service of the registrar of record identified in this output for information on how to contact the registrant, admin, or tech contact of the queried domain name.</registrant_email>
<registrant_phone>REDACTED FOR PRIVACY</registrant_phone>
<registrant_fax>REDACTED FOR PRIVACY</registrant_fax>
<name_servers>
<value>ns-1256.awsdns-29.org</value>
<value>ns-1793.awsdns-32.co.uk</value>
<value>ns-395.awsdns-49.com</value>
<value>ns-695.awsdns-22.net</value>
</name_servers>
<domain_status>
<value>ok</value>
</domain_status>
<dns_sec>
<value>unsigned</value>
</dns_sec>
</value>
<value>
<num>76</num>
<domain_name>innovationhomegroup.com</domain_name>
<domain_keyword>innovationhomegroup</domain_keyword>
<domain_tld>com</domain_tld>
<query_time>2024-03-19 01:18:49</query_time>
<create_date>2020-04-08</create_date>
<update_date>2022-10-10</update_date>
<expiry_date>2025-04-08</expiry_date>
<registrar_iana>1387</registrar_iana>
<registrar_name>1API GmbH</registrar_name>
<registrar_website>http://www.1api.net</registrar_website>
<registrant_name>REDACTED FOR PRIVACY</registrant_name>
<registrant_company>REDACTED FOR PRIVACY</registrant_company>
<registrant_address>REDACTED FOR PRIVACY</registrant_address>
<registrant_city>REDACTED FOR PRIVACY</registrant_city>
<registrant_state>-</registrant_state>
<registrant_zip>REDACTED FOR PRIVACY</registrant_zip>
<registrant_country>FI</registrant_country>
<registrant_email>contact via https://www.1api.net/send-message/innovationhomegroup.com/registrant</registrant_email>
<registrant_phone>REDACTED FOR PRIVACY</registrant_phone>
<name_servers>
<value>ns1.domainhotelli.fi</value>
<value>ns2.domainhotelli.fi</value>
</name_servers>
<domain_status>
<value>clientTransferProhibited</value>
</domain_status>
<dns_sec>
<value>unsigned</value>
</dns_sec>
</value>
<value>
<num>77</num>
<domain_name>innovationhomeshop.com</domain_name>
<domain_keyword>innovationhomeshop</domain_keyword>
<domain_tld>com</domain_tld>
<query_time>2024-03-19 01:18:49</query_time>
<create_date>2020-04-08</create_date>
<update_date>2022-10-10</update_date>
<expiry_date>2025-04-08</expiry_date>
<registrar_iana>1387</registrar_iana>
<registrar_name>1API GmbH</registrar_name>
<registrar_website>http://www.1api.net</registrar_website>
<name_servers>
<value>ns1.domainhotelli.fi</value>
<value>ns2.domainhotelli.fi</value>
</name_servers>
<domain_status>
<value>clientTransferProhibited</value>
</domain_status>
<dns_sec>
<value>unsigned</value>
</dns_sec>
</value>
<value>
<num>78</num>
<domain_name>innovationhome.info</domain_name>
<domain_keyword>innovationhome</domain_keyword>
<domain_tld>info</domain_tld>
<query_time>2024-03-19 01:18:49</query_time>
<create_date>2020-04-08</create_date>
<update_date>2022-09-10</update_date>
<expiry_date>2025-04-08</expiry_date>
<registrar_iana>1387</registrar_iana>
<registrar_name>1API GmbH</registrar_name>
<registrar_website>http://www.1api.net</registrar_website>
<registrant_name>REDACTED FOR PRIVACY</registrant_name>
<registrant_company>Registrant of innovationhome.info</registrant_company>
<registrant_address>REDACTED FOR PRIVACY</registrant_address>
<registrant_city>REDACTED FOR PRIVACY</registrant_city>
<registrant_state>West Yorkshire</registrant_state>
<registrant_zip>REDACTED FOR PRIVACY</registrant_zip>
<registrant_country>GB</registrant_country>
<registrant_email>please query the rdds service of the registrar of record identified in this output for information on how to contact the registrant, admin, or tech contact of the queried domain name.</registrant_email>
<registrant_phone>REDACTED FOR PRIVACY</registrant_phone>
<registrant_fax>REDACTED FOR PRIVACY</registrant_fax>
<name_servers>
<value>ns1.domainhotelli.fi</value>
<value>ns2.domainhotelli.fi</value>
</name_servers>
<domain_status>
<value>clientTransferProhibited</value>
</domain_status>
<dns_sec>
<value>unsigned</value>
</dns_sec>
</value>
<value>
<num>79</num>
<domain_name>innovationhomeworld.com</domain_name>
<domain_keyword>innovationhomeworld</domain_keyword>
<domain_tld>com</domain_tld>
<query_time>2024-03-19 01:18:49</query_time>
<create_date>2020-04-08</create_date>
<update_date>2022-10-10</update_date>
<expiry_date>2025-04-08</expiry_date>
<registrar_iana>1387</registrar_iana>
<registrar_name>1API GmbH</registrar_name>
<registrar_website>http://www.1api.net</registrar_website>
<name_servers>
<value>ns1.domainhotelli.fi</value>
<value>ns2.domainhotelli.fi</value>
</name_servers>
<domain_status>
<value>clientTransferProhibited</value>
</domain_status>
<dns_sec>
<value>unsigned</value>
</dns_sec>
</value>
<value>
<num>80</num>
<domain_name>goesbattery.com</domain_name>
<domain_keyword>goesbattery</domain_keyword>
<domain_tld>com</domain_tld>
<query_time>2024-03-19 01:19:22</query_time>
<create_date>2020-04-08</create_date>
<update_date>2023-03-13</update_date>
<expiry_date>2025-04-08</expiry_date>
<registrar_iana>420</registrar_iana>
<registrar_name>Alibaba Cloud Computing (Beijing) Co., Ltd.</registrar_name>
<registrar_website>http://www.net.cn</registrar_website>
<registrant_state>shang hai</registrant_state>
<registrant_country>CN</registrant_country>
<registrant_email>https://whois.aliyun.com/whois/whoisform</registrant_email>
<name_servers>
<value>ns-1028.awsdns-00.org</value>
<value>ns-1969.awsdns-54.co.uk</value>
<value>ns-351.awsdns-43.com</value>
<value>ns-635.awsdns-15.net</value>
</name_servers>
<domain_status>
<value>ok</value>
</domain_status>
<dns_sec>
<value>unsigned</value>
</dns_sec>
</value>
<value>
<num>81</num>
<domain_name>avalon-lab.coop</domain_name>
<domain_keyword>avalon-lab</domain_keyword>
<domain_tld>coop</domain_tld>
<query_time>2024-03-19 01:26:50</query_time>
<create_date>2020-04-08</create_date>
<update_date>2024-03-13</update_date>
<expiry_date>2025-04-08</expiry_date>
<registrar_iana>81</registrar_iana>
<registrar_name>Gandi SAS</registrar_name>
<registrar_website>www.gandi.net</registrar_website>
<registrant_name>REDACTED FOR PRIVACY</registrant_name>
<registrant_company>Avalon Lab</registrant_company>
<registrant_address>REDACTED FOR PRIVACY</registrant_address>
<registrant_city>REDACTED FOR PRIVACY</registrant_city>
<registrant_zip>REDACTED FOR PRIVACY</registrant_zip>
<registrant_country>FR</registrant_country>
<registrant_email>please query the rdds service of the registrar of record identified in this output for information on how to contact the registrant, admin, or tech contact of the queried domain name.</registrant_email>
<registrant_phone>REDACTED FOR PRIVACY</registrant_phone>
<registrant_fax>REDACTED FOR PRIVACY</registrant_fax>
<name_servers>
<value>ns-107-a.gandi.net</value>
<value>ns-37-b.gandi.net</value>
<value>ns-40-c.gandi.net</value>
</name_servers>
<domain_status>
<value>clientTransferProhibited</value>
</domain_status>
<dns_sec>
<value>unsigned</value>
</dns_sec>
</value>
<value>
<num>82</num>
<domain_name>active-coin.xyz</domain_name>
<domain_keyword>active-coin</domain_keyword>
<domain_tld>xyz</domain_tld>
<query_time>2024-03-19 01:41:53</query_time>
<create_date>2020-04-08</create_date>
<update_date>2024-03-09</update_date>
<expiry_date>2025-04-08</expiry_date>
<registrar_iana>1449</registrar_iana>
<registrar_name>URL Solutions Inc.</registrar_name>
<registrar_website>https://pananames.com</registrar_website>
<registrant_company>GLOBAL DOMAIN PRIVACY SERVICES INC</registrant_company>
<registrant_state>NA</registrant_state>
<registrant_country>PA</registrant_country>
<registrant_email>please query the rdds service of the registrar of record identified in this output for information on how to contact the registrant, admin, or tech contact of the queried domain name.</registrant_email>
<name_servers>
<value>pns41.cloudns.net</value>
<value>pns42.cloudns.net</value>
<value>pns43.cloudns.net</value>
<value>pns44.cloudns.net</value>
</name_servers>
<domain_status>
<value>clientTransferProhibited</value>
</domain_status>
<dns_sec>
<value>unsigned</value>
</dns_sec>
</value>
<value>
<num>83</num>
<domain_name>active-senior-net.com</domain_name>
<domain_keyword>active-senior-net</domain_keyword>
<domain_tld>com</domain_tld>
<query_time>2024-03-19 01:42:07</query_time>
<create_date>2020-04-08</create_date>
<update_date>2023-11-09</update_date>
<expiry_date>2025-04-08</expiry_date>
<registrar_iana>1557</registrar_iana>
<registrar_name>Netowl, Inc.</registrar_name>
<registrar_website>www.star-domain.jp</registrar_website>
<registrant_name>Xserver Xserver Inc.</registrant_name>
<registrant_company>Xserver Inc.</registrant_company>
<registrant_address>GRAND FRONT OSAKA TOWER A 13F, 4-20 Ofukacho, Kita-ku</registrant_address>
<registrant_city>Osaka</registrant_city>
<registrant_state>Osaka</registrant_state>
<registrant_zip>5300011</registrant_zip>
<registrant_country>JP</registrant_country>
<registrant_email>[email protected]</registrant_email>
<registrant_phone>+81.662928811</registrant_phone>
<name_servers>
<value>ns1.xserver.jp</value>
<value>ns2.xserver.jp</value>
<value>ns3.xserver.jp</value>
<value>ns4.xserver.jp</value>
<value>ns5.xserver.jp</value>
</name_servers>
<domain_status>
<value>- https://www.icann.org/epp#</value>
</domain_status>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>84</num>
<domain_name>ecic.online</domain_name>
<domain_keyword>ecic</domain_keyword>
<domain_tld>online</domain_tld>
<query_time>2024-03-19 01:45:35</query_time>
<create_date>2020-04-08</create_date>
<update_date>2024-03-08</update_date>
<expiry_date>2025-04-08</expiry_date>
<registrar_iana>81</registrar_iana>
<registrar_name>Gandi SAS</registrar_name>
<registrar_website>http://www.gandi.net/</registrar_website>
<registrant_country>FR</registrant_country>
<registrant_email>please query the rdds service of the registrar of record identified in this output for information on how to contact the registrant, admin, or tech contact of the queried domain name.</registrant_email>
<name_servers>
<value>ldnsie1p.e-i.net</value>
<value>ldnsie2p.e-i.net</value>
<value>ldnsse1p.e-i.net</value>
<value>ldnsse2p.e-i.net</value>
</name_servers>
<domain_status>
<value>clientTransferProhibited</value>
</domain_status>
<dns_sec>
<value>unsigned</value>
</dns_sec>
</value>
<value>
<num>85</num>
<domain_name>eco-rns.com</domain_name>
<domain_keyword>eco-rns</domain_keyword>
<domain_tld>com</domain_tld>
<query_time>2024-03-19 01:48:11</query_time>
<create_date>2020-04-08</create_date>
<update_date>2022-10-12</update_date>
<expiry_date>2025-04-08</expiry_date>
<registrar_iana>244</registrar_iana>
<registrar_name>gabia</registrar_name>
<registrar_website>https://www.gabia.com</registrar_website>
<registrant_name>Ryu Kyu Bo</registrant_name>
<registrant_address>487, Chungnyeol-daero, Dongnae-gu, Busan</registrant_address>
<registrant_city>Busan</registrant_city>
<registrant_zip>47798</registrant_zip>
<registrant_country>KR</registrant_country>
<registrant_email>[email protected]</registrant_email>
<registrant_phone>+82.515232601</registrant_phone>
<name_servers>
<value>ns.gabia.co.kr</value>
<value>ns.gabia.net</value>
<value>ns1.gabia.co.kr</value>
</name_servers>
<domain_status>
<value>ok</value>
</domain_status>
<dns_sec>
<value>unsigned</value>
</dns_sec>
</value>
<value>
<num>86</num>
<domain_name>micmacsttropez.net</domain_name>
<domain_keyword>micmacsttropez</domain_keyword>
<domain_tld>net</domain_tld>
<query_time>2024-03-19 02:01:11</query_time>
<create_date>2020-04-08</create_date>
<update_date>2024-03-14</update_date>
<expiry_date>2025-04-08</expiry_date>
<registrar_iana>81</registrar_iana>
<registrar_name>Gandi SAS</registrar_name>
<registrar_website>http://www.gandi.net</registrar_website>
<name_servers>
<value>ns-1-a.gandi.net</value>
<value>ns-123-c.gandi.net</value>
<value>ns-87-b.gandi.net</value>
</name_servers>
<domain_status>
<value>clientTransferProhibited</value>
</domain_status>
<dns_sec>
<value>unsigned</value>
</dns_sec>
</value>
<value>
<num>87</num>
<domain_name>beltimpex.com</domain_name>
<domain_keyword>beltimpex</domain_keyword>
<domain_tld>com</domain_tld>
<query_time>2024-03-19 02:05:37</query_time>
<create_date>2020-04-08</create_date>
<update_date>2020-07-15</update_date>
<expiry_date>2025-04-07</expiry_date>
<registrar_iana>463</registrar_iana>
<registrar_name>Regional Network Information Center, JSC dba RU-CENTER</registrar_name>
<registrar_website>http://www.nic.ru</registrar_website>
<registrant_name>TPK Beltimpex Ltd</registrant_name>
<registrant_company>TPK Beltimpex Ltd</registrant_company>
<registrant_address>Yaroslavskoe shosse, dom 146, korpus 2, etazh 3, pom. 302</registrant_address>
<registrant_city>Moscow</registrant_city>
<registrant_state>Moscow</registrant_state>
<registrant_zip>129347</registrant_zip>
<registrant_country>RU</registrant_country>
<registrant_email>[email protected]</registrant_email>
<registrant_phone>+7.4954119146</registrant_phone>
<name_servers>
<value>ns1.agora.ru</value>
<value>ns2.agora.ru</value>
</name_servers>
<domain_status>
<value>clientTransferProhibited</value>
</domain_status>
<dns_sec>
<value>unsigned</value>
</dns_sec>
</value>
<value>
<num>88</num>
<domain_name>clairdelunerosporden.com</domain_name>
<domain_keyword>clairdelunerosporden</domain_keyword>
<domain_tld>com</domain_tld>
<query_time>2024-03-19 02:18:17</query_time>
<create_date>2020-04-08</create_date>
<update_date>2024-03-14</update_date>
<expiry_date>2026-04-08</expiry_date>
<registrar_iana>3817</registrar_iana>
<registrar_name>Wix.com Ltd.</registrar_name>
<registrar_website>http://www.wix.com</registrar_website>
<name_servers>
<value>ns4.wixdns.net</value>
<value>ns5.wixdns.net</value>
</name_servers>
<domain_status>
<value>clientTransferProhibited</value>
<value>clientUpdateProhibited</value>
</domain_status>
<dns_sec>
<value>unsigned</value>
</dns_sec>
</value>
<value>
<num>89</num>
<domain_name>authormx.com</domain_name>
<domain_keyword>authormx</domain_keyword>
<domain_tld>com</domain_tld>
<query_time>2024-03-19 02:20:54</query_time>
<create_date>2020-04-08</create_date>
<update_date>2024-03-15</update_date>
<expiry_date>2025-04-08</expiry_date>
<registrar_iana>48</registrar_iana>
<registrar_name>ENOM, INC.</registrar_name>
<registrar_website>WWW.ENOMDOMAINS.COM</registrar_website>
<registrant_name>REDACTED FOR PRIVACY</registrant_name>
<registrant_company>REDACTED FOR PRIVACY</registrant_company>
<registrant_address>REDACTED FOR PRIVACY</registrant_address>
<registrant_city>REDACTED FOR PRIVACY</registrant_city>
<registrant_state>MA</registrant_state>
<registrant_zip>REDACTED FOR PRIVACY</registrant_zip>
<registrant_country>US</registrant_country>
<registrant_email>https://tieredaccess.com/contact/ad0375ff-31ba-47b3-960d-623179eafe16</registrant_email>
<registrant_phone>REDACTED FOR PRIVACY</registrant_phone>
<registrant_fax>REDACTED FOR PRIVACY</registrant_fax>
<name_servers>
<value>lara.ns.cloudflare.com</value>
<value>tim.ns.cloudflare.com</value>
</name_servers>
<domain_status>
<value>clientTransferProhibited</value>
<value>renewPeriod</value>
</domain_status>
<dns_sec>
<value>unsigned</value>
</dns_sec>
</value>
<value>
<num>90</num>
<domain_name>distanciationsociale.ca</domain_name>
<domain_keyword>distanciationsociale</domain_keyword>
<domain_tld>ca</domain_tld>
<query_time>2024-03-19 02:32:26</query_time>
<create_date>2020-04-08</create_date>
<update_date>2024-03-18</update_date>
<expiry_date>2025-04-08</expiry_date>
<registrar_name>WHC Online Solutions Inc.</registrar_name>
<registrar_website>https://whc.ca</registrar_website>
<registrant_name>Junior Tifo Consultant</registrant_name>
<registrant_company>Junior Tifo Consultant</registrant_company>
<registrant_address>271 Ste-Marie</registrant_address>
<registrant_city>St-Boniface</registrant_city>
<registrant_state>QC</registrant_state>
<registrant_zip>G0X2L0</registrant_zip>
<registrant_country>CA</registrant_country>
<registrant_email>[email protected]</registrant_email>
<registrant_phone>+1.8196681073</registrant_phone>
<name_servers>
<value>ns1.odedi91204.mywhc.ca</value>
<value>ns2.odedi91204.mywhc.ca</value>
</name_servers>
<domain_status>
<value>clientTransferProhibited</value>
</domain_status>
<dns_sec>
<value>unsigned</value>
</dns_sec>
</value>
<value>
<num>91</num>
<domain_name>viperbestass.com</domain_name>
<domain_keyword>viperbestass</domain_keyword>
<domain_tld>com</domain_tld>
<query_time>2024-03-19 02:34:39</query_time>
<create_date>2020-04-08</create_date>
<update_date>2023-06-23</update_date>
<expiry_date>2025-04-08</expiry_date>
<registrar_iana>1910</registrar_iana>
<registrar_name>Cloudflare, Inc.</registrar_name>
<registrar_website>https://www.cloudflare.com</registrar_website>
<registrant_name>DATA REDACTED</registrant_name>
<registrant_company>DATA REDACTED</registrant_company>
<registrant_address>DATA REDACTED</registrant_address>
<registrant_city>DATA REDACTED</registrant_city>
<registrant_state>CA</registrant_state>
<registrant_zip>DATA REDACTED</registrant_zip>
<registrant_country>US</registrant_country>
<registrant_email>https://domaincontact.cloudflareregistrar.com/viperbestass.com</registrant_email>
<registrant_phone>DATA REDACTED</registrant_phone>
<registrant_fax>DATA REDACTED</registrant_fax>
<name_servers>
<value>lina.ns.cloudflare.com</value>
<value>todd.ns.cloudflare.com</value>
</name_servers>
<domain_status>
<value>clientTransferProhibited</value>
</domain_status>
<dns_sec>
<value>unsigned</value>
</dns_sec>
</value>
<value>
<num>92</num>
<domain_name>sidehustlesavior.com</domain_name>
<domain_keyword>sidehustlesavior</domain_keyword>
<domain_tld>com</domain_tld>
<query_time>2024-03-19 02:36:03</query_time>
<create_date>2020-04-08</create_date>
<update_date>2024-03-15</update_date>
<expiry_date>2025-04-08</expiry_date>
<registrar_iana>1068</registrar_iana>
<registrar_name>NAMECHEAP INC</registrar_name>
<registrar_website>http://www.namecheap.com</registrar_website>
<registrant_name>Redacted for Privacy</registrant_name>
<registrant_company>Privacy service provided by Withheld for Privacy ehf</registrant_company>
<registrant_address>Kalkofnsvegur 2</registrant_address>
<registrant_city>Reykjavik</registrant_city>
<registrant_state>Capital Region</registrant_state>
<registrant_zip>101</registrant_zip>
<registrant_country>IS</registrant_country>
<registrant_email>[email protected]</registrant_email>
<registrant_phone>+354.4212434</registrant_phone>
<name_servers>
<value>ns44.wpxhosting.com</value>
<value>ns45.wpxhosting.com</value>
</name_servers>
<domain_status>
<value>clientTransferProhibited</value>
<value>renewPeriod</value>
</domain_status>
<dns_sec>
<value>unsigned</value>
</dns_sec>
</value>
<value>
<num>93</num>
<domain_name>disus.net</domain_name>
<domain_keyword>disus</domain_keyword>
<domain_tld>net</domain_tld>
<query_time>2024-03-19 02:36:59</query_time>
<create_date>2020-04-08</create_date>
<update_date>2024-03-11</update_date>
<expiry_date>2026-04-08</expiry_date>
<registrar_iana>1895</registrar_iana>
<registrar_name>Namespro Solutions INC.</registrar_name>
<registrar_website>http://www.namespro.ca</registrar_website>
<registrant_name>Namespro.ca PrivateWHOIS</registrant_name>
<registrant_company>Namespro.ca PrivateWHOIS</registrant_company>
<registrant_address>PO Box 97083, RICHMOND PO MAIN</registrant_address>
<registrant_city>Richmond</registrant_city>
<registrant_state>BC</registrant_state>
<registrant_zip>V6X8H3</registrant_zip>
<registrant_country>CA</registrant_country>
<registrant_email>[email protected]</registrant_email>
<registrant_phone>+1.6046828059</registrant_phone>
<name_servers>
<value>slns1.namespro.ca</value>
<value>slns2.namespro.ca</value>
</name_servers>
<domain_status>
<value>clientTransferProhibited</value>
</domain_status>
<dns_sec>
<value>Unsigned</value>
</dns_sec>
</value>
<value>
<num>94</num>
<domain_name>haciendalasadelitas.com</domain_name>
<domain_keyword>haciendalasadelitas</domain_keyword>
<domain_tld>com</domain_tld>
<query_time>2024-03-19 02:42:14</query_time>
<create_date>2020-04-08</create_date>
<update_date>2020-04-08</update_date>
<expiry_date>2025-04-08</expiry_date>
<registrar_iana>146</registrar_iana>
<registrar_name>GoDaddy.com, LLC</registrar_name>
<registrar_website>https://www.godaddy.com</registrar_website>
<registrant_name>Registration Private</registrant_name>
<registrant_company>Domains By Proxy, LLC</registrant_company>
<registrant_address>DomainsByProxy.com, 2155 E Warner Rd</registrant_address>
<registrant_city>Tempe</registrant_city>
<registrant_state>Arizona</registrant_state>
<registrant_zip>85284</registrant_zip>
<registrant_country>US</registrant_country>
<registrant_email>select contact domain holder link at https://www.godaddy.com/whois/results.aspx?domain=haciendalasadelitas.com</registrant_email>
<registrant_phone>+1.4806242599</registrant_phone>
<name_servers>
<value>ns45.domaincontrol.com</value>
<value>ns46.domaincontrol.com</value>
</name_servers>
<domain_status>
<value>clientDeleteProhibited</value>
<value>clientRenewProhibited</value>
<value>clientTransferProhibited</value>
<value>clientUpdateProhibited</value>
</domain_status>
<dns_sec>
<value>unsigned</value>
</dns_sec>
</value>
<value>
<num>95</num>
<domain_name>findmythoughts.com</domain_name>
<domain_keyword>findmythoughts</domain_keyword>
<domain_tld>com</domain_tld>
<query_time>2024-03-19 03:30:50</query_time>
<create_date>2020-04-08</create_date>
<update_date>2024-03-09</update_date>
<expiry_date>2025-04-08</expiry_date>
<registrar_iana>1531</registrar_iana>
<registrar_name>Automattic Inc.</registrar_name>
<registrar_website>http://www.automattic.com/</registrar_website>
<registrant_name>Private Whois</registrant_name>
<registrant_company>Knock Knock WHOIS Not There, LLC</registrant_company>
<registrant_address>9450 SW Gemini Dr #63259</registrant_address>
<registrant_city>Beaverton</registrant_city>
<registrant_zip>97008-7105</registrant_zip>
<registrant_country>US</registrant_country>
<registrant_email>[email protected]</registrant_email>
<registrant_phone>+1.8772738550</registrant_phone>
<name_servers>
<value>ns1.wordpress.com</value>
<value>ns2.wordpress.com</value>
<value>ns3.wordpress.com</value>
</name_servers>
<domain_status>
<value>clientTransferProhibited</value>
</domain_status>
<dns_sec>
<value>unsigned</value>
</dns_sec>
</value>
<value>
<num>96</num>
<domain_name>findnowi.com</domain_name>
<domain_keyword>findnowi</domain_keyword>
<domain_tld>com</domain_tld>
<query_time>2024-03-19 03:30:56</query_time>
<create_date>2020-04-08</create_date>
<update_date>2023-03-10</update_date>
<expiry_date>2025-04-08</expiry_date>
<registrar_iana>1068</registrar_iana>
<registrar_name>NAMECHEAP INC</registrar_name>
<registrar_website>http://www.namecheap.com</registrar_website>
<registrant_name>Redacted for Privacy</registrant_name>
<registrant_company>Privacy service provided by Withheld for Privacy ehf</registrant_company>
<registrant_address>Kalkofnsvegur 2</registrant_address>
<registrant_city>Reykjavik</registrant_city>
<registrant_state>Capital Region</registrant_state>
<registrant_zip>101</registrant_zip>
<registrant_country>IS</registrant_country>
<registrant_email>[email protected]</registrant_email>
<registrant_phone>+354.4212434</registrant_phone>
<name_servers>
<value>dns1.registrar-servers.com</value>
<value>dns2.registrar-servers.com</value>
</name_servers>
<domain_status>
<value>clientTransferProhibited</value>
</domain_status>
<dns_sec>
<value>unsigned</value>
</dns_sec>
</value>
<value>
<num>97</num>
<domain_name>findwalks.com</domain_name>
<domain_keyword>findwalks</domain_keyword>
<domain_tld>com</domain_tld>
<query_time>2024-03-19 03:32:49</query_time>
<create_date>2020-04-08</create_date>
<update_date>2021-04-02</update_date>
<expiry_date>2025-04-08</expiry_date>
<registrar_iana>1441</registrar_iana>
<registrar_name>TurnCommerce, Inc. DBA NameBright.com</registrar_name>
<registrar_website>https://www.NameBright.com</registrar_website>
<registrant_name>Domain Admin / This Domain is For Sale</registrant_name>
<registrant_company>HugeDomains.com</registrant_company>
<registrant_address>2635 Walnut Street</registrant_address>
<registrant_city>Denver</registrant_city>
<registrant_state>CO</registrant_state>
<registrant_zip>80205</registrant_zip>
<registrant_country>US</registrant_country>
<registrant_email>[email protected]</registrant_email>
<registrant_phone>+1.3038930552</registrant_phone>
<name_servers>
<value>nsg1.namebrightdns.com</value>
<value>nsg2.namebrightdns.com</value>
</name_servers>
<domain_status>
<value>clientTransferProhibited</value>
</domain_status>
<dns_sec>
<value>unsigned</value>
</dns_sec>
</value>
<value>
<num>98</num>
<domain_name>findyourhappinesstest.com</domain_name>
<domain_keyword>findyourhappinesstest</domain_keyword>
<domain_tld>com</domain_tld>
<query_time>2024-03-19 03:33:28</query_time>
<create_date>2020-04-08</create_date>
<update_date>2024-03-05</update_date>
<expiry_date>2025-04-08</expiry_date>
<registrar_iana>468</registrar_iana>
<registrar_name>Amazon Registrar, Inc.</registrar_name>
<registrar_website>https://registrar.amazon.com</registrar_website>
<registrant_name>On behalf of findyourhappinesstest.com owner</registrant_name>
<registrant_company>Identity Protection Service</registrant_company>
<registrant_address>PO Box 786</registrant_address>
<registrant_city>Hayes</registrant_city>
<registrant_state>Middlesex</registrant_state>
<registrant_zip>UB3 9TR</registrant_zip>
<registrant_country>GB</registrant_country>
<registrant_email>[email protected]</registrant_email>
<registrant_phone>+44.1483307527</registrant_phone>
<registrant_fax>+44.1483304031</registrant_fax>
<name_servers>
<value>ns-1118.awsdns-11.org</value>
<value>ns-1931.awsdns-49.co.uk</value>
<value>ns-21.awsdns-02.com</value>
<value>ns-837.awsdns-40.net</value>
</name_servers>
<domain_status>
<value>ok</value>
</domain_status>
<dns_sec>
<value>unsigned</value>
</dns_sec>
</value>
<value>
<num>99</num>
<domain_name>the-sample-design.com</domain_name>
<domain_keyword>the-sample-design</domain_keyword>
<domain_tld>com</domain_tld>
<query_time>2024-03-19 03:35:18</query_time>
<create_date>2020-04-08</create_date>
<update_date>2024-03-11</update_date>
<expiry_date>2025-04-08</expiry_date>
<registrar_iana>49</registrar_iana>
<registrar_name>GMO INTERNET, INC.</registrar_name>
<registrar_website>http://www.onamae.com</registrar_website>
<registrant_name>Whois Privacy Protection Service by MuuMuuDomain</registrant_name>
<registrant_company>Whois Privacy Protection Service by MuuMuuDomain</registrant_company>
<registrant_address>2-7-21 Tenjin Chuo-ku, Tenjin Prime 8F</registrant_address>
<registrant_city>Fukuoka-shi</registrant_city>
<registrant_state>Fukuoka</registrant_state>
<registrant_zip>810-0001</registrant_zip>
<registrant_country>JP</registrant_country>
<registrant_email>[email protected]</registrant_email>
<registrant_phone>+81.927137999</registrant_phone>
<registrant_fax>+81.927137944</registrant_fax>
<name_servers>
<value>dns01.muumuu-domain.com</value>
<value>dns02.muumuu-domain.com</value>
</name_servers>
<domain_status>
<value>clientTransferProhibited</value>
</domain_status>
<dns_sec>
<value>unsigned</value>
</dns_sec>
</value>
<value>
<num>100</num>
<domain_name>the51x.com</domain_name>
<domain_keyword>the51x</domain_keyword>
<domain_tld>com</domain_tld>
<query_time>2024-03-19 03:37:40</query_time>
<create_date>2020-04-08</create_date>
<update_date>2022-03-25</update_date>
<expiry_date>2025-04-08</expiry_date>
<registrar_iana>100</registrar_iana>
<registrar_name>Whois Corp.</registrar_name>
<registrar_website>http://www.whois.co.kr</registrar_website>
<registrant_name>cho sangeun</registrant_name>
<registrant_company>cho sangeun</registrant_company>
<registrant_address>34 Sangamsan-ro Mapo-gu Seoul 18</registrant_address>
<registrant_city>floor</registrant_city>
<registrant_zip>03909</registrant_zip>
<registrant_country>KR</registrant_country>
<registrant_email>[email protected]</registrant_email>
<registrant_phone>+82.23237331</registrant_phone>
<name_servers>
<value>ns1.whoisdomain.kr</value>
<value>ns2.whoisdomain.kr</value>
<value>ns3.whoisdomain.kr</value>
<value>ns4.whoisdomain.kr</value>
</name_servers>
<domain_status>
<value>clientTransferProhibited</value>
</domain_status>
<dns_sec>
<value>unsigned</value>
</dns_sec>
</value>
</results>
<search_after>1710819460000_1930128</search_after>
<stats>
<total_time>0.564</total_time>
<api_credits_used>1</api_credits_used>
<cost_calculation>1 (search_fields[create_date])</cost_calculation>
</stats>
</root>
API Pricing and Packages
Can be used for Current WHOIS API, Bulk WHOIS API, WHOIS History API, Reverse WHOIS API and Fuzzy Domains API.
Package | Quantity | Price | Rate ⇩ | Order |
---|---|---|---|---|
5,000 API Credits | 5,000 | $25 | $5.00 | Buy Now |
25,000 API Credits | 25,000 | $100 | $4.00 | Buy Now |
250,000 API Credits | 250,000 | $750 | $3.00 | Buy Now |
1 Million API Credits Most Popular | 1,000,000 | $2,000 | $2.00 | Buy Now |
10 Million API Credits | 10,000,000 | $10,000 | $1.00 | Buy Now |
API Credits you purchase have lifetime validity, and you may use it whenever you wish. We accept Visa, Mastercard, American Express, Discover, Diners Club, JCB and China UnionPay. Popular payment wallets like Apple Pay, Google Pay, Alipay, WeChat Pay & Cash App Pay are accepted. You can also pay in installments through Buy Now, Pay Later (Affirm, Afterpay, Clearpay, Klarna) services. For orders worth $1000 and higher, you can also pay through Bank Wire Transfer (ACH, Fedwire and SWIFT). We also accept crypto payments through Bitcoin, Ethereum, Tether, Binance, Ripple and 100+ Cryptocurrencies.
Reverse WHOIS Lookup
You may test our powerful Reverse WHOIS API using the below form.